Clone LD25151 Report

Search the DGRC for LD25151

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:251
Well:51
Vector:pOT2
Associated Gene/TranscriptZif-RA
Protein status:LD25151.pep: gold
Preliminary Size:1547
Sequenced Size:1443

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10267 2001-01-01 Release 2 assignment
CG10267 2001-12-12 Blastp of sequenced clone
CG10267 2003-01-01 Sim4 clustering to Release 3
CG10267 2008-04-29 Release 5.5 accounting
CG10267 2008-08-15 Release 5.9 accounting
CG10267 2008-12-18 5.12 accounting

Clone Sequence Records

LD25151.complete Sequence

1443 bp (1443 high quality bases) assembled on 2001-12-12

GenBank Submission: AY070544

> LD25151.complete
CAGTCGCTTTACACAACACTTTAGCAACACAAATTTTAACACTACAATAC
TACGCGAGCGGTTCTTTAAATTAAATTTCGAGCAGGATTCCAGAATGCGC
GTCGAGCTTACCCCACAGACGTGCCGGGTCTGCCTGGCGCAGAGTGAGCG
ACTGCAGCGCCTAGACGAGATCCGCGAGGAAGGCGAGGAATCGCCGAACG
AGATGTTGATTCAACTTTTGGGAGTCTCATACAGCAATCTGAACGACAGA
GAACACATACCCGATGGCATCTGCAAGTCCTGCAAGGTCGAACTCAACAT
GGCCTACCAGTTTCGCGAGAAGGCGCTGCGCAAGCAGATGGAGATTGAGG
AGTACTGCCGGGAACTGGGCTTGCTGGACGAATCAGATGTGATGATGATC
AAGGAGGAGGACGGCTCGCAGCAGCAATGCGACGAGGAGATGTACATCCT
GGAGGAGACCACCACCGGGGAAGAGGAGCACCAGGAAGAAAAGGGGCACG
AGGAGTACTTGGAAGTGGACACCAGCGATCAGCAGGAGTGCATTGGCGAC
ACCATCGAGTACTTGGAGGACAACTACACCATCGAGATGAACTCCGATCA
GACCGAGATCGTCCTGGAGTCTGAGAAGCAGTACGAAGAGACACCATCGC
AGCAGTTGGCGCTGCAGGAGGCGGCCAAGGCAAGCCTGAAGGCGCGGCGC
GGCCGGGTTCGTCGCGGATTAAACTCCCTAACAACATCGGACGGCACTGA
GAAGGGTGGCTATATCTGCGACGTCTGCGGAAACTTTTACGAAAAGCGCG
GCCGGATGATGGAGCATCGCAGACGCCATGACGGCATCTGCCAATATGCA
TGCGAACTATGCGATGCCAAGTTCCAGGTGCGCGAGCAACTGAGGAAGCA
CATGTACTCCCACACGGGCAGCAAACCCTATAAGTGCAGCTTCTGCAGTC
GTCAATTCTTCTACGAAAGTGTTCTCAAGTCTCATGAAAATGTTCACCGT
GGCATCAAGCCCTACGTGTGCAAGGTGTGCGACAAAGCGTTTGCCTACGC
TCACTCCCTGACCAAGCACGAGCTCATCCACTCGGACATCAAACTGTACC
GCTGCGATTATTGCAACAAGGACTTCCGTCTGCTGCATCACATGCGCCAG
CACGAGGAGACCAAACTGCACCAGAACGCCGTAATGCTGGCCGAGAGCAT
GAAGGTGGAAATGGTGGCCGAGCAGGGGGGCGGGAACGAGATCCGAATTC
AAGCTCACTGACGCAATCAAATTCAGTAGAGTATACTGTCTTATTTCCAG
ATATAATCCCTTATAATCAGTAATACTAGCTTAAACGCTAACGGATAGCG
TATTCATAGTTGTAAGAATGAACTTCATACGTAAATAAAGGTTATTTTTG
TTAAAAATAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

LD25151.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:49:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG10267-RA 1682 CG10267-RA 230..1641 1..1412 7060 100 Plus
CG10267.a 1579 CG10267.a 193..1579 24..1410 6935 100 Plus
CG10267-RB 1394 CG10267-RB 69..1394 85..1410 6630 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 13:28:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2283222..2283838 239..855 3085 100 Plus
chr3R 27901430 chr3R 2284132..2284551 991..1410 2085 99.8 Plus
chr3R 27901430 chr3R 2282922..2283159 1..238 1190 100 Plus
chr3R 27901430 chr3R 2283896..2284030 856..990 675 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:28:55
Subject Length Description Subject Range Query Range Score Percent Strand
Zif-RC 1167 CG10267-PC 1..1167 95..1261 5835 100 Plus
Zif-RB 1167 CG10267-PB 1..1167 95..1261 5835 100 Plus
Zif-RA 1167 CG10267-PA 1..1167 95..1261 5835 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:17:11 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:28:54
Subject Length Description Subject Range Query Range Score Percent Strand
Zif-RA 1463 CG10267-RA 54..1463 1..1410 7050 100 Plus
Zif-RC 1455 CG10267-RC 69..1455 24..1410 6935 100 Plus
Zif-RB 1394 CG10267-RB 69..1394 85..1410 6630 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:28:57
Subject Length Description Subject Range Query Range Score Percent Strand
Zif-PC 388 CG10267-PC 1..388 95..1258 1949 100 Plus
Zif-PB 388 CG10267-PB 1..388 95..1258 1949 100 Plus
Zif-PA 388 CG10267-PA 1..388 95..1258 1949 100 Plus
M1BP-PA 418 CG9797-PA 2..409 89..1246 371 26.9 Plus
ranshi-PA 346 CG9793-PA 4..342 116..1201 367 26.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:28:52
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6457493..6458109 239..855 3085 100 Plus
3R 32079331 3R 6458403..6458824 991..1412 2110 100 Plus
3R 32079331 3R 6457193..6457430 1..238 1190 100 Plus
3R 32079331 3R 6458167..6458301 856..990 675 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:15:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6198324..6198940 239..855 3085 100 Plus
3R 31820162 3R 6199234..6199655 991..1412 2110 100 Plus
3R 31820162 3R 6198024..6198261 1..238 1190 100 Plus
3R 31820162 3R 6198998..6199132 856..990 675 100 Plus
Blast to na_te.dros performed on 2014-11-27 13:28:53 has no hits.

LD25151.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 15:35:23 Download gff for LD25151.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2284132..2284551 991..1410 99   Plus
chr3R 2283896..2284030 856..990 100 -> Plus
chr3R 2283222..2283838 239..855 100 -> Plus
chr3R 2282922..2283159 1..238 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:04:09 Download gff for LD25151.complete
Subject Subject Range Query Range Percent Splice Strand
CG10267-RA 1..1167 95..1261 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:17:53 Download gff for LD25151.complete
Subject Subject Range Query Range Percent Splice Strand
CG10267-RB 1..1167 95..1261 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:30:58 Download gff for LD25151.complete
Subject Subject Range Query Range Percent Splice Strand
Zif-RA 1..1167 95..1261 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:43:59 Download gff for LD25151.complete
Subject Subject Range Query Range Percent Splice Strand
CG10267-RA 1..1167 95..1261 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:35:23 Download gff for LD25151.complete
Subject Subject Range Query Range Percent Splice Strand
Zif-RA 1..1167 95..1261 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:50:41 Download gff for LD25151.complete
Subject Subject Range Query Range Percent Splice Strand
CG10267-RA 40..1449 1..1410 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:17:53 Download gff for LD25151.complete
Subject Subject Range Query Range Percent Splice Strand
CG10267-RA 40..1449 1..1410 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:30:58 Download gff for LD25151.complete
Subject Subject Range Query Range Percent Splice Strand
Zif-RA 54..1463 1..1410 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:43:59 Download gff for LD25151.complete
Subject Subject Range Query Range Percent Splice Strand
CG10267-RA 40..1449 1..1410 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:35:23 Download gff for LD25151.complete
Subject Subject Range Query Range Percent Splice Strand
Zif-RA 54..1463 1..1410 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:35:23 Download gff for LD25151.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6458403..6458822 991..1410 100   Plus
3R 6458167..6458301 856..990 100 -> Plus
3R 6457493..6458109 239..855 100 -> Plus
3R 6457193..6457430 1..238 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:30:58 Download gff for LD25151.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2284125..2284544 991..1410 100   Plus
arm_3R 2283889..2284023 856..990 100 -> Plus
arm_3R 2283215..2283831 239..855 100 -> Plus
arm_3R 2282915..2283152 1..238 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:20:13 Download gff for LD25151.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6199234..6199653 991..1410 100   Plus
3R 6198998..6199132 856..990 100 -> Plus
3R 6198324..6198940 239..855 100 -> Plus
3R 6198024..6198261 1..238 100 -> Plus

LD25151.hyp Sequence

Translation from 0 to 1260

> LD25151.hyp
SRFTQHFSNTNFNTTILRERFFKLNFEQDSRMRVELTPQTCRVCLAQSER
LQRLDEIREEGEESPNEMLIQLLGVSYSNLNDREHIPDGICKSCKVELNM
AYQFREKALRKQMEIEEYCRELGLLDESDVMMIKEEDGSQQQCDEEMYIL
EETTTGEEEHQEEKGHEEYLEVDTSDQQECIGDTIEYLEDNYTIEMNSDQ
TEIVLESEKQYEETPSQQLALQEAAKASLKARRGRVRRGLNSLTTSDGTE
KGGYICDVCGNFYEKRGRMMEHRRRHDGICQYACELCDAKFQVREQLRKH
MYSHTGSKPYKCSFCSRQFFYESVLKSHENVHRGIKPYVCKVCDKAFAYA
HSLTKHELIHSDIKLYRCDYCNKDFRLLHHMRQHEETKLHQNAVMLAESM
KVEMVAEQGGGNEIRIQAH*

LD25151.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:06:16
Subject Length Description Subject Range Query Range Score Percent Strand
Zif-PC 388 CG10267-PC 1..388 32..419 2065 100 Plus
Zif-PB 388 CG10267-PB 1..388 32..419 2065 100 Plus
Zif-PA 388 CG10267-PA 1..388 32..419 2065 100 Plus
M1BP-PA 418 CG9797-PA 2..409 30..415 400 27.2 Plus
CG14710-PB 415 CG14710-PB 10..400 41..392 384 27.7 Plus

LD25151.pep Sequence

Translation from 94 to 1260

> LD25151.pep
MRVELTPQTCRVCLAQSERLQRLDEIREEGEESPNEMLIQLLGVSYSNLN
DREHIPDGICKSCKVELNMAYQFREKALRKQMEIEEYCRELGLLDESDVM
MIKEEDGSQQQCDEEMYILEETTTGEEEHQEEKGHEEYLEVDTSDQQECI
GDTIEYLEDNYTIEMNSDQTEIVLESEKQYEETPSQQLALQEAAKASLKA
RRGRVRRGLNSLTTSDGTEKGGYICDVCGNFYEKRGRMMEHRRRHDGICQ
YACELCDAKFQVREQLRKHMYSHTGSKPYKCSFCSRQFFYESVLKSHENV
HRGIKPYVCKVCDKAFAYAHSLTKHELIHSDIKLYRCDYCNKDFRLLHHM
RQHEETKLHQNAVMLAESMKVEMVAEQGGGNEIRIQAH*

LD25151.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 23:59:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18364-PA 382 GF18364-PA 1..376 1..387 1606 77.7 Plus
Dana\GF16841-PA 430 GF16841-PA 12..412 9..373 353 28.3 Plus
Dana\GF22251-PA 535 GF22251-PA 8..409 2..353 344 30.3 Plus
Dana\GF17340-PA 324 GF17340-PA 11..307 10..361 327 27 Plus
Dana\GF17634-PA 504 GF17634-PA 272..476 152..354 325 34 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 23:59:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13457-PA 388 GG13457-PA 1..388 1..388 1963 94.8 Plus
Dere\GG15653-PA 441 GG15653-PA 12..411 10..356 354 28.4 Plus
Dere\GG17429-PA 418 GG17429-PA 12..404 9..377 352 28.3 Plus
Dere\GG17430-PA 347 GG17430-PA 4..332 8..360 340 27.8 Plus
Dere\GG16354-PA 64 GG16354-PA 1..64 325..388 306 90.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 23:59:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19537-PA 404 GH19537-PA 1..376 1..372 1414 72 Plus
Dgri\GH17279-PA 474 GH17279-PA 14..446 9..356 344 25.8 Plus
Dgri\GH18111-PA 383 GH18111-PA 7..368 10..363 339 27.8 Plus
Dgri\GH23235-PA 468 GH23235-PA 1..436 1..356 337 28.3 Plus
Dgri\GH19509-PA 437 GH19509-PA 284..419 225..360 326 41.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:59:04
Subject Length Description Subject Range Query Range Score Percent Strand
Zif-PC 388 CG10267-PC 1..388 1..388 2065 100 Plus
Zif-PB 388 CG10267-PB 1..388 1..388 2065 100 Plus
Zif-PA 388 CG10267-PA 1..388 1..388 2065 100 Plus
M1BP-PA 418 CG9797-PA 12..409 9..384 399 27.6 Plus
CG14710-PB 415 CG14710-PB 10..400 10..361 384 27.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 23:59:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23015-PA 428 GI23015-PA 1..400 1..372 1430 70.1 Plus
Dmoj\GI22443-PA 453 GI22443-PA 16..425 37..356 346 26.6 Plus
Dmoj\GI24612-PA 380 GI24612-PA 7..365 10..363 343 27.8 Plus
Dmoj\GI24611-PA 417 GI24611-PA 45..400 54..361 334 30.4 Plus
Dmoj\GI22393-PA 359 GI22393-PA 33..345 39..363 324 26 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 23:59:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21751-PA 397 GL21751-PA 1..387 1..378 1365 67.4 Plus
Dper\GL22112-PA 374 GL22112-PA 7..372 10..376 349 27.2 Plus
Dper\GL22111-PA 571 GL22111-PA 203..554 55..351 334 27.3 Plus
Dper\GL12519-PA 457 GL12519-PA 223..425 161..356 324 34 Plus
Dper\GL12521-PA 328 GL12521-PA 10..318 9..371 312 26.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 23:59:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10205-PB 387 GA10205-PB 1..377 1..378 1361 69.8 Plus
Dpse\GA13193-PA 374 GA13193-PA 7..372 10..376 353 27.2 Plus
Dpse\GA13192-PA 410 GA13192-PA 8..396 24..361 347 26.8 Plus
Dpse\GA18168-PA 457 GA18168-PA 223..425 161..356 320 34 Plus
Dpse\GA18174-PA 329 GA18174-PA 10..319 9..371 313 26.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 23:59:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10897-PA 388 GM10897-PA 1..388 1..388 1902 95.1 Plus
Dsec\GM17691-PA 426 GM17691-PA 20..395 9..353 358 28.8 Plus
Dsec\GM17699-PA 342 GM17699-PA 11..336 10..375 347 25.9 Plus
Dsec\GM23957-PA 415 GM23957-PA 10..402 10..363 342 28.9 Plus
Dsec\GM23958-PA 377 GM23958-PA 7..367 10..364 327 26 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 23:59:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19876-PA 347 GD19876-PA 1..347 1..388 1722 85.8 Plus
Dsim\GD18767-PA 415 GD18767-PA 10..402 10..363 347 28.3 Plus
Dsim\GD20849-PA 397 GD20849-PA 51..378 8..359 331 28.2 Plus
Dsim\GD15791-PA 574 GD15791-PA 300..448 209..353 327 42.3 Plus
Dsim\GD18768-PA 377 GD18768-PA 7..367 10..364 323 26.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 23:59:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24609-PA 430 GJ24609-PA 1..400 1..370 1432 70.4 Plus
Dvir\GJ11005-PA 479 GJ11005-PA 14..459 9..364 336 25.7 Plus
Dvir\GJ22562-PA 378 GJ22562-PA 7..363 10..363 335 27.4 Plus
Dvir\GJ24586-PA 743 GJ24586-PA 400..729 55..360 329 26.6 Plus
Dvir\GJ10169-PA 460 GJ10169-PA 290..425 221..356 323 41.9 Plus
Dvir\GJ10169-PA 460 GJ10169-PA 283..395 242..354 208 35.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 23:59:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13499-PA 413 GK13499-PA 1..391 1..370 1381 66.3 Plus
Dwil\GK22769-PA 370 GK22769-PA 8..358 10..361 350 28.7 Plus
Dwil\GK11271-PA 440 GK11271-PA 11..431 8..373 339 27.1 Plus
Dwil\GK11270-PA 359 GK11270-PA 4..355 10..371 326 26.6 Plus
Dwil\GK22797-PA 346 GK22797-PA 12..334 10..370 324 26.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 23:59:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10222-PA 388 GE10222-PA 1..388 1..388 1953 94.3 Plus
Dyak\GE24830-PA 418 GE24830-PA 12..399 9..371 350 27.5 Plus
Dyak\GE24184-PA 413 GE24184-PA 10..411 10..374 344 28.6 Plus
Dyak\GE16037-PA 562 GE16037-PA 214..436 134..353 338 35.2 Plus
Dyak\GE24832-PA 344 GE24832-PA 4..338 8..366 326 26.9 Plus