Clone LD25202 Report

Search the DGRC for LD25202

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:252
Well:2
Vector:pOT2
Associated Gene/TranscriptJra-RA
Protein status:LD25202.pep: gold
Preliminary Size:1613
Sequenced Size:1525

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2275 2001-09-19 Blastp of sequenced clone
CG2275 2003-01-01 Sim4 clustering to Release 3
Jra 2008-04-29 Release 5.5 accounting
Jra 2008-08-15 Release 5.9 accounting
Jra 2008-12-18 5.12 accounting

Clone Sequence Records

LD25202.complete Sequence

1525 bp (1525 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058562

> LD25202.complete
AGCACTCATTCTGAAAACAACCTTGCGCGTAATAAATATTTTCGTAAAAT
TATTTAGCGAAACCAAAATAAAAATCAAACGATTCGTTGGCCGATAAAAC
CGGTGATTAAGCAGTGGCAGTGCAGAAAGCAGAAAACACAAAAGTACAGA
TTGTGCTAATCAAATTTTGCAAGCAAAGTTCCCACCCACTGATTGACGTC
ATTGCTTGAGCAAACATGAAAACCCCCGTTTCCGCTGCTGCGAACTTAAG
TATTCAGAATGCTGGCAGTTCCGGAGCAACTGCCATTCAGATCATACCTA
AAACCGAGCCCGTTGGAGAAGAAGGCCCCATGTCACTGGACTTTCAGTCG
CCGAACCTGAACACATCCACCCCGAATCCTAACAAGCGTCCCGGCTCGCT
GGATCTGAACAGCAAGAGTGCCAAGAACAAGCGCATCTTCGCACCACTGG
TCATCAACTCACCGGATCTGTCATCCAAGACGGTAAACACACCCGATTTG
GAGAAGATCCTGCTATCCAACAATCTGATGCAAACACCGCAGCCGGGAAA
GGTGTTCCCCACCAAGGCGGGGCCCGTCACCGTGGAGCAGTTGGACTTCG
GCAGGGGATTCGAGGAGGCCTTACACAATCTTCACACTAACTCCCAGGCA
TTTCCGTCCGCCAATTCCGCCGCTAATTCCGCCGCCAATAACACAACTGC
GGCAGCCATGACAGCGGTGAACAATGGCATCAGCGGAGGCACCTTCACCT
ACACCAACATGACCGAGGGCTTCTCGGTGATTAAGGACGAGCCCGTCAAT
CAAGCCAGCTCGCCCACCGTTAATCCCATTGACATGGAAGCGCAGGAGAA
GATCAAGCTGGAGCGCAAGAGGCAGCGTAACCGTGTGGCTGCATCCAAGT
GCCGCAAGCGCAAGTTGGAGCGCATCTCAAAGCTGGAGGATCGCGTGAAG
GTACTTAAGGGCGAGAACGTCGACCTGGCTAGCATCGTGAAGAACCTCAA
GGACCATGTGGCGCAGCTGAAGCAGCAGGTGATGGAGCACATTGCCGCGG
GCTGCACGGTGCCGCCGAACTCGACAGACCAATAACATTTGGAGTTGTCA
GCCGGGGAGAATGATGAGGAGGACGTGGCACTGGAGACTGAAACCCCCTC
GAATCCTGAAGATCCCGAGCAACCCATGCCTCTGGAATTCTTTTCAAGTG
CTAGCACCGGTGCCTTGGAGCTGGAGGGCTCGGCCTCTCAGGATATTTCC
CTAACTAACAGCGAACTCCTGGAGGAGGAGAGCGATAACGAACAGCCTCT
GGTGCTCTACATCCTCGCGGACGACGCAACCTGAGGCTTTGTGCCTTTCT
TTGGTTTTAGCTGCAATATCTGAAATGCTTCTTAAGTGTTTTGTTTACTT
AGTTATTAGTATAAGCTAGTGTTAATCAAGTATTATCTGTGTTGAACGTA
AGATAATATGTAATGTACTTTTAAAATATACGTATATTTTCTGCACTTGA
TATATAAAAAAAAAAAAAAAAAAAA

LD25202.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:19:52
Subject Length Description Subject Range Query Range Score Percent Strand
Jra-RA 1543 Jra-RA 39..1543 1..1505 7525 100 Plus
Jra.a 1941 Jra.a 437..1941 1..1505 7525 100 Plus
Jra-RB 1565 Jra-RB 118..1565 58..1505 7240 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:37:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5984797..5986111 191..1505 6545 99.8 Plus
chr2R 21145070 chr2R 5984503..5984693 1..191 955 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:37:02
Subject Length Description Subject Range Query Range Score Percent Strand
Jra-RC 1119 CG2275-PC 1..1119 216..1334 5595 100 Plus
Jra-RA 870 CG2275-PA 1..870 216..1085 4350 100 Plus
Jra-RB 870 CG2275-PB 1..870 216..1085 4350 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:17:12 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:37:01
Subject Length Description Subject Range Query Range Score Percent Strand
Jra-RC 1525 CG2275-RC 21..1525 1..1505 7525 100 Plus
Jra-RA 1525 CG2275-RA 21..1525 1..1505 7525 100 Plus
Jra-RB 1565 CG2275-RB 118..1565 58..1505 7240 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:37:04
Subject Length Description Subject Range Query Range Score Percent Strand
Jra-PC 372 CG2275-PC 1..372 216..1331 1571 99.7 Plus
Jra-PA 289 CG2275-PA 1..289 216..1082 1252 100 Plus
Jra-PB 289 CG2275-PB 1..289 216..1082 1252 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:36:59
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10097242..10098567 191..1516 6600 99.8 Plus
2R 25286936 2R 10096948..10097138 1..191 955 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:42:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10098441..10099766 191..1516 6600 99.8 Plus
2R 25260384 2R 10098147..10098337 1..191 955 100 Plus
Blast to na_te.dros performed on 2014-11-27 03:37:00 has no hits.

LD25202.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:57:42 Download gff for LD25202.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5984798..5986111 192..1505 96   Plus
chr2R 5984503..5984693 1..191 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:04:10 Download gff for LD25202.complete
Subject Subject Range Query Range Percent Splice Strand
Jra-RA 1..870 216..1085 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:03:04 Download gff for LD25202.complete
Subject Subject Range Query Range Percent Splice Strand
Jra-RA 1..870 216..1085 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:06:25 Download gff for LD25202.complete
Subject Subject Range Query Range Percent Splice Strand
Jra-RC 1..1119 216..1334 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:33:39 Download gff for LD25202.complete
Subject Subject Range Query Range Percent Splice Strand
Jra-RA 1..870 216..1085 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:57:42 Download gff for LD25202.complete
Subject Subject Range Query Range Percent Splice Strand
Jra-RC 1..1119 216..1334 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:51:37 Download gff for LD25202.complete
Subject Subject Range Query Range Percent Splice Strand
Jra-RA 12..1516 1..1505 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:03:04 Download gff for LD25202.complete
Subject Subject Range Query Range Percent Splice Strand
Jra-RA 12..1516 1..1505 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:06:25 Download gff for LD25202.complete
Subject Subject Range Query Range Percent Splice Strand
Jra-RA 21..1525 1..1505 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:33:39 Download gff for LD25202.complete
Subject Subject Range Query Range Percent Splice Strand
Jra-RA 12..1516 1..1505 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:57:42 Download gff for LD25202.complete
Subject Subject Range Query Range Percent Splice Strand
Jra-RA 21..1525 1..1505 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:57:42 Download gff for LD25202.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10097243..10098556 192..1505 100   Plus
2R 10096948..10097138 1..191 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:06:25 Download gff for LD25202.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5984748..5986061 192..1505 100   Plus
arm_2R 5984453..5984643 1..191 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:10:29 Download gff for LD25202.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10098442..10099755 192..1505 100   Plus
2R 10098147..10098337 1..191 100 -> Plus

LD25202.pep Sequence

Translation from 215 to 1084

> LD25202.pep
MKTPVSAAANLSIQNAGSSGATAIQIIPKTEPVGEEGPMSLDFQSPNLNT
STPNPNKRPGSLDLNSKSAKNKRIFAPLVINSPDLSSKTVNTPDLEKILL
SNNLMQTPQPGKVFPTKAGPVTVEQLDFGRGFEEALHNLHTNSQAFPSAN
SAANSAANNTTAAAMTAVNNGISGGTFTYTNMTEGFSVIKDEPVNQASSP
TVNPIDMEAQEKIKLERKRQRNRVAASKCRKRKLERISKLEDRVKVLKGE
NVDLASIVKNLKDHVAQLKQQVMEHIAAGCTVPPNSTDQ*

LD25202.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 04:29:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12018-PA 355 GF12018-PA 1..286 1..288 1032 74 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 04:29:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24138-PA 285 GG24138-PA 1..285 1..289 1318 87.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 04:29:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21247-PA 309 GH21247-PA 25..297 26..282 822 64.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 04:29:43
Subject Length Description Subject Range Query Range Score Percent Strand
Jra-PA 289 CG2275-PA 1..289 1..289 1462 100 Plus
Jra-PB 289 CG2275-PB 1..289 1..289 1462 100 Plus
Jra-PC 372 CG2275-PC 1..289 1..289 1462 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 04:29:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20534-PA 283 GI20534-PA 12..276 15..280 898 70 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 04:29:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17608-PA 293 GL17608-PA 27..282 26..283 1072 80 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 04:29:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA30492-PB 293 GA30492-PB 27..282 26..283 1072 80 Plus
Dpse\GA30492-PA 404 GA30492-PA 27..282 26..283 1068 80 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 04:29:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21184-PA 285 GM21184-PA 1..285 1..289 1328 94.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 04:29:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15385-PA 289 GD15385-PA 1..289 1..289 1355 96.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 04:29:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22384-PA 292 GJ22384-PA 14..280 15..282 926 70.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 04:29:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21594-PA 281 GK21594-PA 21..275 26..286 886 69.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 04:29:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19337-PA 284 GE19337-PA 1..284 1..289 1352 90.7 Plus

LD25202.hyp Sequence

Translation from 215 to 1084

> LD25202.hyp
MKTPVSAAANLSIQNAGSSGATAIQIIPKTEPVGEEGPMSLDFQSPNLNT
STPNPNKRPGSLDLNSKSAKNKRIFAPLVINSPDLSSKTVNTPDLEKILL
SNNLMQTPQPGKVFPTKAGPVTVEQLDFGRGFEEALHNLHTNSQAFPSAN
SAANSAANNTTAAAMTAVNNGISGGTFTYTNMTEGFSVIKDEPVNQASSP
TVNPIDMEAQEKIKLERKRQRNRVAASKCRKRKLERISKLEDRVKVLKGE
NVDLASIVKNLKDHVAQLKQQVMEHIAAGCTVPPNSTDQ*

LD25202.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:26:53
Subject Length Description Subject Range Query Range Score Percent Strand
Jra-PA 289 CG2275-PA 1..289 1..289 1462 100 Plus
Jra-PB 289 CG2275-PB 1..289 1..289 1462 100 Plus
Jra-PC 372 CG2275-PC 1..289 1..289 1462 100 Plus