Clone LD25605 Report

Search the DGRC for LD25605

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:256
Well:5
Vector:pOT2
Associated Gene/TranscriptAnxB10-RA
Protein status:LD25605.pep: gold
Preliminary Size:1338
Sequenced Size:1235

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9579 2001-01-01 Release 2 assignment
CG9579 2001-10-10 Blastp of sequenced clone
CG9579 2003-01-01 Sim4 clustering to Release 3
AnnX 2008-04-29 Release 5.5 accounting
AnnX 2008-08-15 Release 5.9 accounting
AnnX 2008-12-18 5.12 accounting

Clone Sequence Records

LD25605.complete Sequence

1235 bp (1235 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061328

> LD25605.complete
AGACGTCGCAAGAAGAATTCGCAAAAAAGTCCCAGGAGAAAGACTGATTC
GTGTGAAGTCGTCTACTGAAGAGCCACAAGGAACCCAAGGAATCTTCCAG
CTGCATAATGGAATACAAACCCGTGCCCACGGTTAAGGACGCAGCTCCCT
TCGACGCCTCCCAGGACGCCCAGGTGCTGCGGGCGGCGATGAAGGGATTC
GGCACCGACGAGCAGGAAATCATCGACGTGCTCGTCGGCAGGAGCAACCA
GCAGAGGCAGACGATCAAGGCGGTTTACGAAGCGGAGTTCGAGCGCGACC
TGGTGGACGATCTTAAGGACGAGCTGGGAGGCAAGTTCGAGGACGTGATC
GTGGGTCTAATGATGCCACCAGTGGAGTACCTGTGCAAGCAACTGCACGC
CGCCATGGCGGGCATCGGAACCGAGGAGGCCACGCTCGTCGAGATCCTGT
GCACCAAGACCAACGAGGAGATGGCCCAGATCGTGGCCGTCTACGAGGAG
CGCTACCAGCGCCCGCTGGCCGAGCAGATGTGCAGCGAGACCTCCGGCTT
TTTCCGCCGCCTGCTCACGCTGATCGTGACCGGAGTACGTGACGGACTGG
ACACGCCCGTCGACGTCGGTCAGGCCAAGGAGCAGGCCGCCCAGCTCTAC
TCGGCCGGCGAGGCCAAGCTGGGAACGGACGAGGAGGTCTTCAACCGGAT
CATGTCGCACGCCAGCTTCCCGCAGCTGCGACTCGTCTTCGAGGAGTACA
AGGTGCTCTCCGGGCAGACCATCGAGCAGGCCATCAAGCACGAGATGTCC
GACGAGCTGCACGAGGCCATGATGGCCATAGTTGAGTGCGTCCAGTCACC
GGCGGCCTTCTTCGCCAACCGCCTGTACAAGGCCATGAATGGCGCCGGCA
CCGATGACGCCACGCTCATCCGCATCATCGTCAGCCGCTCGGAGATCGAC
CTGGAGACCATTAAGCAGGAGTTCGAGCGGATCTACAACCGTACGCTGCA
CAGCGCCGTGGTGGCGGAGACCTCTGGTGACTACAAGCGGGCCCTGACAG
CCCTACTTGGATCCGCCTAGGCCCGAGGATGTGGCAGCTGGTCCGCCCAA
TATTTTATTCGTGTTAATAGCTTTGATCGTAGTGTGCCTTTTAGGAAAAT
CGCTTTTAATGTCGTCTGCGCATGCGCACACTGTTGGCAATAAATAAACG
CATATAGCAGCAGTTGTAAAAAAAAAAAAAAAAAA

LD25605.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:15:09
Subject Length Description Subject Range Query Range Score Percent Strand
AnnX-RA 1250 AnnX-RA 33..1250 1..1218 6090 100 Plus
AnnX-RB 1244 AnnX-RB 25..1244 1..1217 6030 99.7 Plus
nc_24937.a 468 nc_24937.a 1..468 749..1216 2325 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:11:17
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 20060853..20061564 831..120 3560 100 Minus
chrX 22417052 chrX 20083579..20083830 831..580 1230 99.2 Minus
chrX 22417052 chrX 20068020..20068269 831..582 1220 99.2 Minus
chrX 22417052 chrX 20075892..20076141 831..582 1220 99.2 Minus
chrX 22417052 chrX 20091439..20091688 831..582 1220 99.2 Minus
chrX 22417052 chrX 20059993..20060197 1217..1013 1025 100 Minus
chrX 22417052 chrX 20060588..20060773 1014..829 930 100 Minus
chrX 22417052 chrX 20067751..20067936 1014..829 930 100 Minus
chrX 22417052 chrX 20091174..20091359 1014..829 930 100 Minus
chrX 22417052 chrX 20075615..20075800 1014..829 915 99.5 Minus
chrX 22417052 chrX 20083314..20083499 1014..829 915 99.5 Minus
chrX 22417052 chrX 20082795..20082923 1141..1013 645 100 Minus
chrX 22417052 chrX 20067234..20067360 1139..1013 635 100 Minus
chrX 22417052 chrX 20075096..20075224 1141..1013 630 99.2 Minus
chrX 22417052 chrX 20090655..20090783 1141..1013 630 99.2 Minus
chrX 22417052 chrX 20061917..20062035 119..1 580 99.2 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:11:13
Subject Length Description Subject Range Query Range Score Percent Strand
AnxB10-RA 963 CG9579-PA 1..963 108..1070 4815 100 Plus
AnxB10-RB 966 CG9579-PB 1..966 108..1070 4750 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:17:37 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:11:12
Subject Length Description Subject Range Query Range Score Percent Strand
AnxB10-RA 1244 CG9579-RA 28..1244 1..1217 6085 100 Plus
AnxB10-RB 1247 CG9579-RB 28..1247 1..1217 6020 99.8 Plus
CG9578-RA 1094 CG9578-RA 1013..1094 1217..1136 410 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:11:15
Subject Length Description Subject Range Query Range Score Percent Strand
AnxB10-PA 320 CG9579-PA 1..320 108..1067 1604 100 Plus
AnxB10-PB 321 CG9579-PB 1..321 108..1067 1592 99.7 Plus
AnxB11-PF 322 CG9968-PF 7..317 126..1061 750 48.4 Plus
AnxB11-PC 322 CG9968-PC 7..317 126..1061 750 48.4 Plus
AnxB11-PA 322 CG9968-PA 7..317 126..1061 750 48.4 Plus
AnxB11-PF 322 CG9968-PF 32..160 672..1067 179 31.1 Plus
AnxB11-PC 322 CG9968-PC 32..160 672..1067 179 31.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:11:09
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20172305..20173016 831..120 3560 100 Minus
X 23542271 X 20187343..20187594 831..580 1230 99.2 Minus
X 23542271 X 20179468..20179717 831..582 1220 99.2 Minus
X 23542271 X 20195077..20195326 831..582 1220 99.2 Minus
X 23542271 X 20202793..20203042 831..582 1220 99.2 Minus
X 23542271 X 20210463..20210712 831..582 1220 99.2 Minus
X 23542271 X 20218115..20218364 831..582 1220 99.2 Minus
X 23542271 X 20225850..20226099 831..582 1220 99.2 Minus
X 23542271 X 20171443..20171649 1219..1013 1035 100 Minus
X 23542271 X 20172040..20172225 1014..829 930 100 Minus
X 23542271 X 20179203..20179388 1014..829 930 100 Minus
X 23542271 X 20194808..20194993 1014..829 930 100 Minus
X 23542271 X 20202524..20202709 1014..829 930 100 Minus
X 23542271 X 20210194..20210379 1014..829 930 100 Minus
X 23542271 X 20187078..20187263 1014..829 915 99.5 Minus
X 23542271 X 20217850..20218035 1014..829 915 99.5 Minus
X 23542271 X 20225585..20225770 1014..829 915 99.5 Minus
X 23542271 X 20186559..20186687 1141..1013 645 100 Minus
X 23542271 X 20194291..20194417 1139..1013 635 100 Minus
X 23542271 X 20202007..20202133 1139..1013 635 100 Minus
X 23542271 X 20209677..20209803 1139..1013 635 100 Minus
X 23542271 X 20178684..20178812 1141..1013 630 99.2 Minus
X 23542271 X 20217331..20217459 1141..1013 630 99.2 Minus
X 23542271 X 20225066..20225194 1141..1013 630 99.2 Minus
X 23542271 X 20173369..20173487 119..1 595 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:38:47
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 20180403..20181114 831..120 3560 100 Minus
X 23527363 X 20203129..20203380 831..580 1230 99.2 Minus
X 23527363 X 20195442..20195691 831..582 1220 99.2 Minus
X 23527363 X 20187570..20187819 831..582 1220 99.2 Minus
X 23527363 X 20210989..20211238 831..582 1220 99.2 Minus
X 23527363 X 20179541..20179747 1219..1013 1035 100 Minus
X 23527363 X 20187301..20187486 1014..829 930 100 Minus
X 23527363 X 20180138..20180323 1014..829 930 100 Minus
X 23527363 X 20210724..20210909 1014..829 930 100 Minus
X 23527363 X 20202864..20203049 1014..829 915 99.4 Minus
X 23527363 X 20195165..20195350 1014..829 915 99.4 Minus
X 23527363 X 20202345..20202473 1141..1013 645 100 Minus
X 23527363 X 20186784..20186910 1139..1013 635 100 Minus
X 23527363 X 20210205..20210333 1141..1013 630 99.2 Minus
X 23527363 X 20194646..20194774 1141..1013 630 99.2 Minus
X 23527363 X 20181467..20181585 119..1 595 100 Minus
Blast to na_te.dros performed on 2014-11-26 19:11:11 has no hits.

LD25605.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 20:35:37 Download gff for LD25605.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 20061917..20062035 1..119 99   Minus
chrX 20060853..20061564 120..831 100 <- Minus
chrX 20060589..20060770 832..1013 100 <- Minus
chrX 20059993..20060196 1014..1217 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:04:35 Download gff for LD25605.complete
Subject Subject Range Query Range Percent Splice Strand
AnnX-RA 1..963 108..1070 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:56:26 Download gff for LD25605.complete
Subject Subject Range Query Range Percent Splice Strand
AnnX-RA 1..963 108..1070 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 22:06:53 Download gff for LD25605.complete
Subject Subject Range Query Range Percent Splice Strand
AnxB10-RA 1..963 108..1070 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:25:35 Download gff for LD25605.complete
Subject Subject Range Query Range Percent Splice Strand
AnnX-RA 1..963 108..1070 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:35:37 Download gff for LD25605.complete
Subject Subject Range Query Range Percent Splice Strand
AnxB10-RA 1..963 108..1070 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:42:26 Download gff for LD25605.complete
Subject Subject Range Query Range Percent Splice Strand
AnnX-RA 33..1249 1..1217 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:56:26 Download gff for LD25605.complete
Subject Subject Range Query Range Percent Splice Strand
AnnX-RA 33..1249 1..1217 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 22:06:53 Download gff for LD25605.complete
Subject Subject Range Query Range Percent Splice Strand
AnxB10-RA 28..1244 1..1217 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:25:35 Download gff for LD25605.complete
Subject Subject Range Query Range Percent Splice Strand
AnnX-RA 33..1249 1..1217 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:35:37 Download gff for LD25605.complete
Subject Subject Range Query Range Percent Splice Strand
AnxB10-RA 28..1244 1..1217 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 20:35:37 Download gff for LD25605.complete
Subject Subject Range Query Range Percent Splice Strand
X 20173369..20173487 1..119 100   Minus
X 20172305..20173016 120..831 100 <- Minus
X 20172041..20172222 832..1013 100 <- Minus
X 20171445..20171648 1014..1217 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 22:06:53 Download gff for LD25605.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20067402..20067520 1..119 100   Minus
arm_X 20066338..20067049 120..831 100 <- Minus
arm_X 20066074..20066255 832..1013 100 <- Minus
arm_X 20065478..20065681 1014..1217 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:02:46 Download gff for LD25605.complete
Subject Subject Range Query Range Percent Splice Strand
X 20181467..20181585 1..119 100   Minus
X 20180403..20181114 120..831 100 <- Minus
X 20180139..20180320 832..1013 100 <- Minus
X 20179543..20179746 1014..1217 100 <- Minus

LD25605.pep Sequence

Translation from 107 to 1069

> LD25605.pep
MEYKPVPTVKDAAPFDASQDAQVLRAAMKGFGTDEQEIIDVLVGRSNQQR
QTIKAVYEAEFERDLVDDLKDELGGKFEDVIVGLMMPPVEYLCKQLHAAM
AGIGTEEATLVEILCTKTNEEMAQIVAVYEERYQRPLAEQMCSETSGFFR
RLLTLIVTGVRDGLDTPVDVGQAKEQAAQLYSAGEAKLGTDEEVFNRIMS
HASFPQLRLVFEEYKVLSGQTIEQAIKHEMSDELHEAMMAIVECVQSPAA
FFANRLYKAMNGAGTDDATLIRIIVSRSEIDLETIKQEFERIYNRTLHSA
VVAETSGDYKRALTALLGSA*

LD25605.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 03:54:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20448-PA 321 GF20448-PA 4..321 3..320 1505 91.5 Plus
Dana\GF19282-PA 356 GF19282-PA 40..351 6..318 776 47.9 Plus
Dana\GF16493-PA 341 GF16493-PA 9..323 3..318 749 47.5 Plus
Dana\GF19282-PA 356 GF19282-PA 65..194 188..320 175 31.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 03:54:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18007-PA 320 GG18007-PA 1..320 1..320 1655 97.5 Plus
Dere\GG19323-PA 505 GG19323-PA 189..500 6..318 774 48.2 Plus
Dere\GG24321-PA 341 GG24321-PA 9..323 3..318 744 47.2 Plus
Dere\GG19323-PA 505 GG19323-PA 186..343 161..320 175 30.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 03:54:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12087-PA 320 GH12087-PA 1..310 1..310 1332 81.3 Plus
Dgri\GH12030-PA 492 GH12030-PA 176..487 6..318 763 47.3 Plus
Dgri\GH17323-PA 324 GH17323-PA 9..323 3..318 754 47.5 Plus
Dgri\GH12030-PA 492 GH12030-PA 201..330 188..320 170 30.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 03:54:17
Subject Length Description Subject Range Query Range Score Percent Strand
AnxB10-PA 320 CG9579-PA 1..320 1..320 1604 100 Plus
AnxB10-PB 321 CG9579-PB 1..321 1..320 1592 99.7 Plus
AnxB11-PF 322 CG9968-PF 7..317 7..318 750 48.4 Plus
AnxB11-PC 322 CG9968-PC 7..317 7..318 750 48.4 Plus
AnxB11-PA 322 CG9968-PA 7..317 7..318 750 48.4 Plus
AnxB11-PF 322 CG9968-PF 32..160 189..320 179 31.1 Plus
AnxB11-PC 322 CG9968-PC 32..160 189..320 179 31.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 03:54:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11094-PA 320 GI11094-PA 1..320 1..320 1403 81.6 Plus
Dmoj\GI14303-PA 505 GI14303-PA 189..500 6..318 752 46 Plus
Dmoj\GI22446-PA 324 GI22446-PA 9..323 3..318 738 47.5 Plus
Dmoj\GI14303-PA 505 GI14303-PA 214..343 188..320 167 29.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 03:54:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12917-PA 335 GL12917-PA 1..335 1..320 1418 80.6 Plus
Dper\GL15887-PA 512 GL15887-PA 196..507 6..318 766 47 Plus
Dper\GL11940-PA 324 GL11940-PA 9..323 3..318 743 46.8 Plus
Dper\GL15887-PA 512 GL15887-PA 221..350 188..320 174 30.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 03:54:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\AnnX-PA 320 GA22806-PA 1..320 1..320 1504 87.5 Plus
Dpse\GA22156-PA 505 GA22156-PA 189..500 6..318 767 47 Plus
Dpse\GA19090-PA 324 GA19090-PA 9..323 3..318 743 46.8 Plus
Dpse\GA22156-PA 505 GA22156-PA 214..343 188..320 174 30.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 03:54:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22687-PA 320 GM22687-PA 1..320 1..320 1665 98.4 Plus
Dsec\GM13401-PA 322 GM13401-PA 6..317 6..318 783 48.6 Plus
Dsec\GM15061-PA 304 GM15061-PA 9..301 3..316 636 43.3 Plus
Dsec\GM13401-PA 322 GM13401-PA 31..160 188..320 174 30.8 Plus
Dsec\GM15061-PA 304 GM15061-PA 173..303 31..158 155 27.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 03:54:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22929-PA 320 GD22929-PA 1..320 1..320 1672 98.8 Plus
Dsim\GD15750-PA 322 GD15750-PA 6..317 6..318 778 48.2 Plus
Dsim\GD19393-PA 341 GD19393-PA 9..323 3..318 745 47.2 Plus
Dsim\GD15750-PA 322 GD15750-PA 31..160 188..320 174 30.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 03:54:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15779-PA 320 GJ15779-PA 1..320 1..320 1378 83.1 Plus
Dvir\GJ19360-PA 505 GJ19360-PA 189..500 6..318 751 46.3 Plus
Dvir\GJ11008-PA 324 GJ11008-PA 9..323 3..318 744 47.8 Plus
Dvir\GJ19360-PA 505 GJ19360-PA 214..343 188..320 169 30.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 03:54:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25596-PA 320 GK25596-PA 1..320 1..320 1416 84.7 Plus
Dwil\GK25708-PA 672 GK25708-PA 356..667 6..318 763 46 Plus
Dwil\GK14180-PA 324 GK14180-PA 9..323 3..318 747 47.2 Plus
Dwil\GK25708-PA 672 GK25708-PA 381..510 188..320 177 31.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 03:54:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15364-PA 320 GE15364-PA 1..320 1..320 1664 98.1 Plus
Dyak\GE15970-PA 505 GE15970-PA 189..500 6..318 771 47.9 Plus
Dyak\GE15970-PA 505 GE15970-PA 214..343 188..320 171 30.1 Plus

LD25605.hyp Sequence

Translation from 107 to 1069

> LD25605.hyp
MEYKPVPTVKDAAPFDASQDAQVLRAAMKGFGTDEQEIIDVLVGRSNQQR
QTIKAVYEAEFERDLVDDLKDELGGKFEDVIVGLMMPPVEYLCKQLHAAM
AGIGTEEATLVEILCTKTNEEMAQIVAVYEERYQRPLAEQMCSETSGFFR
RLLTLIVTGVRDGLDTPVDVGQAKEQAAQLYSAGEAKLGTDEEVFNRIMS
HASFPQLRLVFEEYKVLSGQTIEQAIKHEMSDELHEAMMAIVECVQSPAA
FFANRLYKAMNGAGTDDATLIRIIVSRSEIDLETIKQEFERIYNRTLHSA
VVAETSGDYKRALTALLGSA*

LD25605.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:05:50
Subject Length Description Subject Range Query Range Score Percent Strand
AnxB10-PA 320 CG9579-PA 1..320 1..320 1604 100 Plus
AnxB10-PB 321 CG9579-PB 1..321 1..320 1592 99.7 Plus
AnxB11-PF 322 CG9968-PF 7..317 7..318 750 48.4 Plus
AnxB11-PC 322 CG9968-PC 7..317 7..318 750 48.4 Plus
AnxB11-PA 322 CG9968-PA 7..317 7..318 750 48.4 Plus
AnxB11-PF 322 CG9968-PF 32..160 189..320 179 31.1 Plus
AnxB11-PC 322 CG9968-PC 32..160 189..320 179 31.1 Plus