Clone LD26767 Report

Search the DGRC for LD26767

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:267
Well:67
Vector:pOT2
Associated Gene/TranscriptMAPk-Ak2-RB
Protein status:LD26767.pep: gold
Sequenced Size:1976

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
MAPk-Ak2-RB 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

LD26767.complete Sequence

1976 bp assembled on 2010-12-09

GenBank Submission: BT125824.1

> LD26767.complete
CTTTTTTTTCGTTCCGTTACATAGCACGCTAAAGTAAATATCCGAAAGTT
AAAGATCAGCCGATTCCAGAATGCTTTCTCTGCAGAATCAACGGCAACCG
AAGACCACCCCACTGACGGACGACTACGTGACCTCGAACACGGTTCTGGG
CTACGGGATCAACGGGAAGGTGGTGCAGTGCACCCATCGCCGCACCCAAC
AGAACTATGCCCTCAAGGTGCTGTTGGACAGTGAAAGGGCGCGTCGCGAA
GTGGACCTGCATTGGCGGGTCAGCGGATGCCGGTACATTGTGAACATCAT
TGATGTGTACGAGAACACGTTTAAGGACAGGAAGTGCCTCCTGGTGGTCA
TGGAGTGCATGGAGGGCGGCGAGCTCTTCCAGAGAATTCAGGACAAGGCC
GACGGTGCCTTTACGGAGCGGGAGGCGGCCCAGATAATGCACGAGATCTG
CGCGGCCGTAGACTATCTGCACAGTCGCGACATAGCGCATCGCGATCTCA
AGCCGGAGAACTTGCTGTACACCACCACTCAGCCGAATGCGACCCTTAAA
TTGACGGACTTTGGCTTCGCCAAGGAGACATTCACCAGTTACACGCTGCA
GACGCCCTGCTACACTCCCTATTACGTGGCTCCTGAGGTTCTGGGCCCGG
AGAAGTACGACAAGAGCTGCGACATCTGGTCGCTGGGCGTGGTGATGTAC
ATCATTATGTGCGGATTCCCGCCGTTCTACAGCAACCACGGCCTAGCCAT
ATCGCCCGGCATGAAAAATCGCATCCGCACCGGCCAGTATGACTTTCCCG
ATCCGGAGTGGACGAATGTGAGCCAGGCGGCAAAGGATCTGATCAAGGGC
ATGCTGAACGTGGACCCCAGCAAGCGTCTGCGCATCCAGGACGTCATTAG
CAACAAGTGGATTGCCCAGTACAATGCTGTTCCACAGACACCGCTCTGCA
CGGGTCGCATGCTAAAGGAGGCCGAGGAAACCTGGCCGGAAGTGCAGGAG
GAGATGACGCGCTCACTGGCCACCATGCGCGTAGACTACGATCAGATGCA
AATCAAGGCGCTGGACAAGTCGAACAACCCGCTGCTGACGAAGCGCAGGA
AAAAGATCGAGGAGATGGAGTTATACATGGCCAATGCGACGCGCAACTAG
ACAACGAGGAATCCAGAGCGACTAACACGGCCAACCCGGGAGTGAGATGA
GATGAGATGAGGAGAGATGGGCGTAGGATGTAGGATGGGCGAACCATCGG
TTTAACACTTAAGCGGATAACAATGTTGTACAATGCTTTACAAAAACGAT
AAATACTACTATACTACGACGGCGGCAAGATCTGCTATTAACTAATATAC
TACGATGACAGCAACCTTTGCAAAACAACTACTCCATGTTATTGTTACGT
TACGTTTTCTTATTCATTTTGTCCCATTATCTATCTATCCATTTCCAGTC
AAGGGTTCTTAGGGTATTTTGTAGTCTGAAAAGTGCTCTTTTGTAAAAGA
AACTATAAAGCGTAATGCGCAAATAACGAACTTAAGTAAAGCCAAGTGCA
AGCCTAGCTAGCCAGCCAGCCCAGCCGAATATTCAAAATGTCTCGGTATC
GCGTGAAAGTGTTTCGTTTTTCGATTCCCTTTTTTTTTTTAAATATTATT
TTCCAAAAACGTGTCATTTGTAACCGAACCGTTTTTTACGTGTACGTGAC
TTTGATTATAATTATATATATATATGTATATGTATAACCGTCTGTGTATG
TATGGCATATGTGTGGAGAAACAATTATACAGCCAGTTCACGTTAGCATT
AATCTGCGCAAGATTCAGTGTTGTTTATAACTTTTATTTGCTGATTCTGC
AAGCGATATACCATTTTACCGTATAGCATATTTGTAGTCCATAAACAACA
AGATCATCCCCCAAATTAATAAAAACAAATCAAGCTTATTTTACTATGAT
TAAAACATAAAAAAAAAAAAAAAAAA

LD26767.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:33:26
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 5652332..5653246 1958..1043 4530 99.9 Minus
chrX 22417052 chrX 5654524..5655106 629..47 2915 100 Minus
chrX 22417052 chrX 5653592..5654008 1045..629 2055 99.5 Minus
chrX 22417052 chrX 5656512..5656564 53..1 250 98.1 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:33:22
Subject Length Description Subject Range Query Range Score Percent Strand
MAPk-Ak2-RF 1080 CG3086-PF 1..1080 71..1150 5400 100 Plus
MAPk-Ak2-RE 1080 CG3086-PE 1..1080 71..1150 5400 100 Plus
MAPk-Ak2-RD 1080 CG3086-PD 1..1080 71..1150 5400 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:33:21
Subject Length Description Subject Range Query Range Score Percent Strand
MAPk-Ak2-RB 2020 CG3086-RB 63..2020 1..1958 9790 100 Plus
MAPk-Ak2-RF 1913 CG3086-RF 2..1913 47..1958 9560 100 Plus
MAPk-Ak2-RD 2045 CG3086-RD 134..2045 47..1958 9560 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:33:24
Subject Length Description Subject Range Query Range Score Percent Strand
MAPk-Ak2-PF 359 CG3086-PF 1..359 71..1147 1907 100 Plus
MAPk-Ak2-PE 359 CG3086-PE 1..359 71..1147 1907 100 Plus
MAPk-Ak2-PD 359 CG3086-PD 1..359 71..1147 1907 100 Plus
MAPk-Ak2-PB 359 CG3086-PB 1..359 71..1147 1907 100 Plus
CaMKI-PI 390 CG1495-PI 56..337 200..1078 445 33.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:33:19
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 5759899..5760823 1967..1043 4610 99.9 Minus
X 23542271 X 5762101..5762683 629..47 2915 100 Minus
X 23542271 X 5761169..5761585 1045..629 2085 100 Minus
X 23542271 X 5764089..5764141 53..1 250 98.1 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:03:45
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 5767997..5768921 1967..1043 4610 99.8 Minus
X 23527363 X 5770199..5770781 629..47 2915 100 Minus
X 23527363 X 5769267..5769683 1045..629 2085 100 Minus
X 23527363 X 5772187..5772239 53..1 250 98.1 Minus
Blast to na_te.dros performed on 2014-11-27 16:33:20 has no hits.

LD26767.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:53:28 Download gff for LD26767.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 5656517..5656564 1..48 100   Minus
chrX 5654524..5655104 49..629 100 <- Minus
chrX 5653592..5654007 630..1045 99 <- Minus
chrX 5652578..5653243 1046..1712 92 <- Minus
chrX 5652332..5652525 1765..1958 100 == Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2010-12-10 09:34:17 Download gff for LD26767.complete
Subject Subject Range Query Range Percent Splice Strand
MAPk-Ak2-RD 1..1080 71..1150 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:34:01 Download gff for LD26767.complete
Subject Subject Range Query Range Percent Splice Strand
MAPk-Ak2-RB 1..1080 71..1150 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:53:28 Download gff for LD26767.complete
Subject Subject Range Query Range Percent Splice Strand
MAPk-Ak2-RD 1..1080 71..1150 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2010-12-10 09:34:17 Download gff for LD26767.complete
Subject Subject Range Query Range Percent Splice Strand
MAPk-Ak2-RB 58..2015 1..1958 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:34:01 Download gff for LD26767.complete
Subject Subject Range Query Range Percent Splice Strand
MAPk-Ak2-RB 63..2020 1..1958 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:53:28 Download gff for LD26767.complete
Subject Subject Range Query Range Percent Splice Strand
MAPk-Ak2-RB 63..2020 1..1958 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:53:28 Download gff for LD26767.complete
Subject Subject Range Query Range Percent Splice Strand
X 5764094..5764141 1..48 100   Minus
X 5762101..5762681 49..629 100 <- Minus
X 5761169..5761584 630..1045 100 <- Minus
X 5759908..5760820 1046..1958 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:34:01 Download gff for LD26767.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 5658127..5658174 1..48 100   Minus
arm_X 5656134..5656714 49..629 100 <- Minus
arm_X 5655202..5655617 630..1045 100 <- Minus
arm_X 5653941..5654853 1046..1958 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:52:23 Download gff for LD26767.complete
Subject Subject Range Query Range Percent Splice Strand
X 5772192..5772239 1..48 100   Minus
X 5770199..5770779 49..629 100 <- Minus
X 5769267..5769682 630..1045 100 <- Minus
X 5768006..5768918 1046..1958 100 <- Minus

LD26767.pep Sequence

Translation from 70 to 1149

> LD26767.pep
MLSLQNQRQPKTTPLTDDYVTSNTVLGYGINGKVVQCTHRRTQQNYALKV
LLDSERARREVDLHWRVSGCRYIVNIIDVYENTFKDRKCLLVVMECMEGG
ELFQRIQDKADGAFTEREAAQIMHEICAAVDYLHSRDIAHRDLKPENLLY
TTTQPNATLKLTDFGFAKETFTSYTLQTPCYTPYYVAPEVLGPEKYDKSC
DIWSLGVVMYIIMCGFPPFYSNHGLAISPGMKNRIRTGQYDFPDPEWTNV
SQAAKDLIKGMLNVDPSKRLRIQDVISNKWIAQYNAVPQTPLCTGRMLKE
AEETWPEVQEEMTRSLATMRVDYDQMQIKALDKSNNPLLTKRRKKIEEME
LYMANATRN*

LD26767.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:43:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21465-PA 360 GF21465-PA 1..360 1..359 1806 91.7 Plus
Dana\GF22801-PA 407 GF22801-PA 104..303 75..282 448 39.9 Plus
Dana\GF21004-PA 1280 GF21004-PA 945..1203 26..281 436 39.1 Plus
Dana\GF16618-PA 1179 GF16618-PA 126..412 19..281 424 35.5 Plus
Dana\GF20823-PA 613 GF20823-PA 28..293 25..283 406 33 Plus
Dana\GF21004-PA 1280 GF21004-PA 568..805 25..270 253 30.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:43:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18472-PA 357 GG18472-PA 1..357 1..359 1778 90.3 Plus
Dere\GG16388-PA 405 GG16388-PA 104..303 75..282 448 39.9 Plus
Dere\GG19750-PA 914 GG19750-PA 577..861 26..295 428 36.3 Plus
Dere\GG17196-PA 1149 GG17196-PA 115..449 19..321 422 32.3 Plus
Dere\GG18438-PA 582 GG18438-PA 28..293 25..283 410 33 Plus
Dere\GG19750-PA 914 GG19750-PA 207..444 25..270 254 30.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:43:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24824-PA 354 GH24824-PA 1..335 1..335 1587 86 Plus
Dgri\GH24012-PA 430 GH24012-PA 104..307 75..286 453 40.1 Plus
Dgri\GH19309-PA 1205 GH19309-PA 136..422 19..281 430 35.8 Plus
Dgri\GH24077-PA 784 GH24077-PA 411..655 26..266 420 39.7 Plus
Dgri\GH24413-PA 603 GH24413-PA 28..293 25..283 407 33 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:43:12
Subject Length Description Subject Range Query Range Score Percent Strand
MAPk-Ak2-PF 359 CG3086-PF 1..359 1..359 1907 100 Plus
MAPk-Ak2-PE 359 CG3086-PE 1..359 1..359 1907 100 Plus
MAPk-Ak2-PD 359 CG3086-PD 1..359 1..359 1907 100 Plus
MAPk-Ak2-PB 359 CG3086-PB 1..359 1..359 1907 100 Plus
CaMKI-PI 390 CG1495-PI 56..337 44..336 445 33.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:43:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16155-PA 355 GI16155-PA 1..349 1..349 1705 88.5 Plus
Dmoj\GI14047-PA 432 GI14047-PA 104..307 75..286 452 39.6 Plus
Dmoj\GI23525-PA 1229 GI23525-PA 113..399 19..281 440 36.5 Plus
Dmoj\GI14475-PA 1196 GI14475-PA 854..1113 26..281 436 37.8 Plus
Dmoj\GI16230-PA 419 GI16230-PA 28..293 25..283 408 33 Plus
Dmoj\GI14475-PA 1196 GI14475-PA 482..719 25..270 255 30.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:43:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14163-PA 358 GL14163-PA 1..355 1..357 1775 91.3 Plus
Dper\GL18141-PA 417 GL18141-PA 104..307 75..286 457 40.1 Plus
Dper\GL12250-PA 1055 GL12250-PA 124..425 19..296 440 35.4 Plus
Dper\GL13301-PA 875 GL13301-PA 538..799 26..281 433 37.5 Plus
Dper\GL15144-PA 605 GL15144-PA 28..293 25..283 405 33 Plus
Dper\GL13301-PA 875 GL13301-PA 168..405 25..270 255 30.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:43:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15916-PA 358 GA15916-PA 1..355 1..357 1775 91.3 Plus
Dpse\GA13377-PA 417 GA13377-PA 104..307 75..286 457 40.1 Plus
Dpse\GA14470-PB 1186 GA14470-PB 71..372 19..296 442 35.7 Plus
Dpse\GA14470-PA 1223 GA14470-PA 124..425 19..296 442 35.7 Plus
Dpse\GA14570-PA 875 GA14570-PA 538..799 26..281 432 37.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:43:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11736-PA 909 GM11736-PA 572..856 26..295 428 36.3 Plus
Dsec\GM26074-PA 1141 GM26074-PA 114..448 19..321 422 32.3 Plus
Dsec\GM13103-PA 609 GM13103-PA 44..325 15..283 405 31.9 Plus
Dsec\GM26797-PA 405 GM26797-PA 104..303 75..282 401 36.5 Plus
Dsec\GM13012-PA 530 GM13012-PA 8..278 13..287 398 33.3 Plus
Dsec\GM11736-PA 909 GM11736-PA 202..439 25..270 255 30.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:43:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16235-PA 331 GD16235-PA 1..326 1..326 1659 92.9 Plus
Dsim\GD17550-PA 909 GD17550-PA 572..856 26..295 432 36.6 Plus
Dsim\GD20638-PA 1179 GD20638-PA 152..486 19..321 423 32.3 Plus
Dsim\GD17041-PA 593 GD17041-PA 32..305 23..283 402 32.4 Plus
Dsim\GD24788-PA 178 GD24788-PA 21..162 75..220 373 46.6 Plus
Dsim\GD17550-PA 909 GD17550-PA 202..439 25..270 255 30.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:43:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16433-PA 355 GJ16433-PA 1..349 1..349 1692 88.5 Plus
Dvir\GJ18812-PA 1257 GJ18812-PA 915..1174 26..281 451 38.2 Plus
Dvir\GJ19665-PA 428 GJ19665-PA 104..307 75..286 447 39.6 Plus
Dvir\GJ10277-PA 1215 GJ10277-PA 114..415 19..296 430 35.1 Plus
Dvir\GJ15921-PA 540 GJ15921-PA 28..293 25..283 411 33 Plus
Dvir\GJ18812-PA 1257 GJ18812-PA 542..779 25..270 255 30.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:43:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10232-PA 364 GK10232-PA 1..355 1..357 1766 90.5 Plus
Dwil\GK13601-PA 437 GK13601-PA 104..307 75..286 442 39.6 Plus
Dwil\GK11984-PA 1212 GK11984-PA 111..397 19..281 426 35.8 Plus
Dwil\GK25774-PA 894 GK25774-PA 538..817 26..281 412 35.5 Plus
Dwil\GK20076-PA 419 GK20076-PA 28..293 25..283 408 33 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:43:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16789-PA 359 GE16789-PA 1..359 1..359 1814 91.9 Plus
Dyak\CaMKI-PA 405 GE14549-PA 104..303 75..282 448 39.9 Plus
Dyak\S6kII-PA 909 GE17944-PA 551..832 10..281 430 37 Plus
Dyak\GE10088-PA 1152 GE10088-PA 118..452 19..321 428 32.6 Plus
Dyak\GE15660-PA 606 GE15660-PA 28..293 25..283 409 33 Plus
Dyak\S6kII-PA 909 GE17944-PA 202..439 25..270 254 30.5 Plus

LD26767.hyp Sequence

Translation from 70 to 1149

> LD26767.hyp
MLSLQNQRQPKTTPLTDDYVTSNTVLGYGINGKVVQCTHRRTQQNYALKV
LLDSERARREVDLHWRVSGCRYIVNIIDVYENTFKDRKCLLVVMECMEGG
ELFQRIQDKADGAFTEREAAQIMHEICAAVDYLHSRDIAHRDLKPENLLY
TTTQPNATLKLTDFGFAKETFTSYTLQTPCYTPYYVAPEVLGPEKYDKSC
DIWSLGVVMYIIMCGFPPFYSNHGLAISPGMKNRIRTGQYDFPDPEWTNV
SQAAKDLIKGMLNVDPSKRLRIQDVISNKWIAQYNAVPQTPLCTGRMLKE
AEETWPEVQEEMTRSLATMRVDYDQMQIKALDKSNNPLLTKRRKKIEEME
LYMANATRN*

LD26767.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:43:10
Subject Length Description Subject Range Query Range Score Percent Strand
MAPk-Ak2-PF 359 CG3086-PF 1..359 1..359 1907 100 Plus
MAPk-Ak2-PE 359 CG3086-PE 1..359 1..359 1907 100 Plus
MAPk-Ak2-PD 359 CG3086-PD 1..359 1..359 1907 100 Plus
MAPk-Ak2-PB 359 CG3086-PB 1..359 1..359 1907 100 Plus
CaMKI-PI 390 CG1495-PI 56..337 44..336 445 33.2 Plus