Clone LD26791 Report

Search the DGRC for LD26791

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:267
Well:91
Vector:pOT2
Associated Gene/Transcriptdrm-RA
Protein status:LD26791.pep: gold
Preliminary Size:2253
Sequenced Size:2297

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10016 2001-01-01 Release 2 assignment
CG10016 2001-11-29 Blastp of sequenced clone
CG10016 2003-01-01 Sim4 clustering to Release 3
drm 2008-04-29 Release 5.5 accounting
drm 2008-08-15 Release 5.9 accounting
drm 2008-12-18 5.12 accounting

Clone Sequence Records

LD26791.complete Sequence

2297 bp (2297 high quality bases) assembled on 2001-11-29

GenBank Submission: AY070883

> LD26791.complete
ATAGTTCCCTCTCATCAGTAACAGTATCAGTAACAACATCAGTAACATTT
CCTTCGCGAGTACCTTCAAAAGAGATACAAATCGATCTATCCATTCAGCG
GACATACGAAAATCGCACAAAACTCAGCTATAGAAATCGGTTAGCCTCTA
CTCGAGTCCGAAGAACGCGTAACTCCAGTGCATCCCATTGGGTGTCTGCC
TTAAAGTGCGCCATAAACTAAAAGCCAAACCTAAACGTCGGCGGTGAGGA
GAAATAAATAACGCCCACCGAAACGCAACACCACCTACTGGTCACCCGTG
GCAAACGAGAAGGGGGCGGAGAGGCGAAATCACGGAACAGCGATATACGG
GCCAAAAAGATAAAGCCGCCAGGACAGGGGAAAGTGGTAGAGGAAGCGAC
GTTGCCGCTCTTCACCGACCAATCAGCCAAGAAGGCAGCAATTAAGCGCG
GTGTTATCTGAACAGATAGCGATTAGAGGCGAGAAAATAGACCCCATTGA
GTGGAAAAGCCCCATTGCCGAGCCAAAGAGCGCGCTAGAGAGGCCGGAAA
GGCGGGAGTCAGCCACGAACGAATCCCCATTTGCCGAGAGCGGGAGCACC
CAGACGGGAGAGCCCCGAGCAGCGCCACATCGTCACACTTCGAGCACCCC
ACTCAAGCACTCAACCTTAAACGCCGGGCACCAGTACACATACCGCCTGT
CAAAATGTTTGCTGTAATGCGAATCGACAACGATGACTGCCGGTCCGATT
TCCGCCGCAAGATGCGTCCGAAGTGCGAGTTCATTTGCAAGTACTGCCAG
CGGCGATTCACCAAGCCGTACAACCTGATGATCCACGAGCGCACCCACAA
GTCCCCTGAGATCACCTATTCGTGCGAGGTGTGCGGCAAGTACTTTAAGC
AGCGGGACAATCTGCGCCAGCACAGATGTAGTCAGTGTGTTTGGCGATAA
GCTTAAATACCACATAAACATATATATAAATATATATAAAACCACACACA
GAGCAATATATAAAGTAAAACCGATATCTAAGCACCGCAGCACCAACAAC
AGCACGCAATATCACAGCTATATCTTACACACATATAATGAATGAATGGG
ATCTGATGAGGCAACTGCAACACACCCCGCCTACTTCTTCATGCACCACT
CTCTAAACATATAAATACCTGCAACAGCAGCAACTGCAACATTGCTTAAA
CCACTAGATGCAATCTACAGCCACGACAAGCGATTATAGTGAACGGAATG
CTACGTTCAGGTGTTGGTTTTCAATCTATTCGGTTATCTGGTCTATACAA
TGCACTTGCCACGCCCCCATCAACAGCAGACAAACACACATATGCAGATG
TTGCGCAGGCGCAGCACAACAGCAGCAGTTGCAGCAATGGCAACGGTTGC
AACAGTTGCAACGCACATTGCAACAGCAGCCTCCATATTTTCAATAATAT
TTCCAGAAATCTTCACATGGACACTTGTGGGCGTGGCTGCTTCGGAAAGT
GATGAAGGCGGCACCTTAAGGCAGCCTGCAACTTGCAACATCTAATAGCT
GAGAACGTGCAACATCCCCAAGTGCAGTGAATAATATAAAGTGCAGCTCT
TAAAGGTGCCAAATCTGAAGAAATCCACCGCTTTATGCTTTTAGCTGCAG
ACTTAACATCTCTACCTGCAAGTGTTAGCATAACTTCCGAAATTTGAGTT
GCAACATCTAGAAGAAGTCCATTCAATCCTACAAGCATCCCACCCATATC
AACACACCAGCAACAGCAGAAATCAACAGAAGTCCCAGCAAAACTCAGCA
AACAACTAACAACAACACATGCAACACAACAGCAACATGTTGCTGCTAGA
TTTCTCATATGTGTTGCACGTGCTGCCAGCGAAAGTGCAATTAAGCCACA
GCTTCTTGGGCTTTTAAAAGTGCGGGCAACAACAGCAACACACAGAGCAG
CACACCAGCAACATGCAGCATACAGCATGCGACGCGGATGCAAAATGCAG
CATGCAACGTGCGACAACTATCAGCTGCAATTATCTTGCCTTAAAACATA
TTACCGATTTACACACATACACACACACTCTCGCTTATTTTATGAATAAT
AAAAATTAATTACAATTTAATAATAATATTTAAAATGCAAAAAATCAAAA
ACAAACACCGACACACTTACGTCATAAGTATTTGTACTTTAAAATCGAAA
GAAAAAACACGTTGAAAATGTATTACATAAAATTAATAATAATTAATAAT
AATAATAATAAAAACAATTATTAAATAAAAAAAAAAAAAAAAAAAAA

LD26791.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:51:04
Subject Length Description Subject Range Query Range Score Percent Strand
drm.c 2715 drm.c 53..2331 1..2279 11395 100 Plus
drm-RA 2333 drm-RA 53..2331 1..2279 11395 100 Plus
drm.e 2548 drm.e 53..2331 1..2279 11395 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 08:56:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3546304..3547656 924..2276 6690 99.6 Plus
chr2L 23010047 chr2L 3544648..3545382 191..925 3615 99.5 Plus
chr2L 23010047 chr2L 3539356..3539548 1..193 950 99.5 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:56:00
Subject Length Description Subject Range Query Range Score Percent Strand
drm-RA 246 CG10016-PA 1..246 705..950 1230 100 Plus
drm-RB 246 CG10016-PB 1..246 705..950 1230 100 Plus
drm-RC 267 CG10016-PC 1..222 705..926 1110 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:18:50 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:55:58
Subject Length Description Subject Range Query Range Score Percent Strand
drm-RA 2330 CG10016-RA 55..2330 1..2276 11380 100 Plus
drm-RB 2572 CG10016-RB 145..2230 191..2276 10430 100 Plus
drm-RC 1799 CG10016-RC 55..980 1..926 4630 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 08:56:03
Subject Length Description Subject Range Query Range Score Percent Strand
drm-PA 81 CG10016-PA 1..81 705..947 466 100 Plus
drm-PB 81 CG10016-PB 1..81 705..947 466 100 Plus
drm-PC 88 CG10016-PC 1..74 705..926 419 100 Plus
odd-PA 392 CG3851-PA 215..281 765..938 203 55.9 Plus
bowl-PH 744 CG10021-PH 230..285 756..926 201 61.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:55:55
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3546729..3548084 924..2279 6780 100 Plus
2L 23513712 2L 3545073..3545807 191..925 3675 100 Plus
2L 23513712 2L 3539787..3539979 1..193 965 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:16:58
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3546729..3548084 924..2279 6780 100 Plus
2L 23513712 2L 3545073..3545807 191..925 3675 100 Plus
2L 23513712 2L 3539787..3539979 1..193 965 100 Plus
Blast to na_te.dros performed 2014-11-27 08:55:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6533..6829 1750..2030 140 57.7 Plus
gypsy4 6852 gypsy4 GYPSY4 6852bp 1763..1812 624..673 115 70 Plus

LD26791.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:18:02 Download gff for LD26791.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3547517..3547601 2137..2221 98 == Plus
chr2L 3546811..3547464 1431..2084 99 == Plus
chr2L 3546306..3546734 926..1354 94 == Plus
chr2L 3544649..3545382 192..925 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:05:51 Download gff for LD26791.complete
Subject Subject Range Query Range Percent Splice Strand
drm-RA 1..246 705..950 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:20:32 Download gff for LD26791.complete
Subject Subject Range Query Range Percent Splice Strand
drm-RA 1..246 705..950 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:11:42 Download gff for LD26791.complete
Subject Subject Range Query Range Percent Splice Strand
drm-RB 1..246 705..950 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:46:48 Download gff for LD26791.complete
Subject Subject Range Query Range Percent Splice Strand
drm-RA 1..246 705..950 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:18:02 Download gff for LD26791.complete
Subject Subject Range Query Range Percent Splice Strand
drm-RB 1..246 705..950 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:54:28 Download gff for LD26791.complete
Subject Subject Range Query Range Percent Splice Strand
drm-RA 53..2328 1..2276 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:20:32 Download gff for LD26791.complete
Subject Subject Range Query Range Percent Splice Strand
drm-RA 53..2328 1..2276 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:11:42 Download gff for LD26791.complete
Subject Subject Range Query Range Percent Splice Strand
drm-RA 55..2330 1..2276 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:46:48 Download gff for LD26791.complete
Subject Subject Range Query Range Percent Splice Strand
drm-RA 53..2328 1..2276 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:18:02 Download gff for LD26791.complete
Subject Subject Range Query Range Percent Splice Strand
drm-RA 55..2330 1..2276 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:18:02 Download gff for LD26791.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3546731..3548081 926..2276 100   Plus
2L 3545074..3545807 192..925 100 -> Plus
2L 3539787..3539977 1..191 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:11:42 Download gff for LD26791.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3546731..3548081 926..2276 100   Plus
arm_2L 3545074..3545807 192..925 100 -> Plus
arm_2L 3539787..3539977 1..191 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:23:12 Download gff for LD26791.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3546731..3548081 926..2276 100   Plus
2L 3545074..3545807 192..925 100 -> Plus
2L 3539787..3539977 1..191 100 -> Plus

LD26791.pep Sequence

Translation from 704 to 949

> LD26791.pep
MFAVMRIDNDDCRSDFRRKMRPKCEFICKYCQRRFTKPYNLMIHERTHKS
PEITYSCEVCGKYFKQRDNLRQHRCSQCVWR*

LD26791.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 01:28:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15244-PA 81 GF15244-PA 1..81 1..81 428 100 Plus
Dana\GF15254-PA 762 GF15254-PA 233..288 18..74 199 61.4 Plus
Dana\GF14663-PA 598 GF14663-PA 410..462 21..74 189 61.1 Plus
Dana\GF14661-PA 390 GF14661-PA 210..262 21..74 186 64.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 01:28:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24954-PA 81 GG24954-PA 1..81 1..81 428 100 Plus
Dere\GG24424-PA 394 GG24424-PA 217..283 21..78 198 55.9 Plus
Dere\GG24967-PA 744 GG24967-PA 230..285 18..74 198 61.4 Plus
Dere\GG24427-PA 585 GG24427-PA 397..449 21..74 176 61.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 01:28:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13695-PA 81 GH13695-PA 1..81 1..81 428 100 Plus
Dgri\GH13710-PA 763 GH13710-PA 225..280 18..74 197 61.4 Plus
Dgri\GH13191-PA 416 GH13191-PA 245..297 21..74 187 64.8 Plus
Dgri\GH13192-PA 656 GH13192-PA 461..513 21..74 179 61.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:28:39
Subject Length Description Subject Range Query Range Score Percent Strand
drm-PA 81 CG10016-PA 1..81 1..81 466 100 Plus
drm-PB 81 CG10016-PB 1..81 1..81 466 100 Plus
drm-PC 88 CG10016-PC 1..74 1..74 419 100 Plus
odd-PA 392 CG3851-PA 215..281 21..78 203 55.9 Plus
bowl-PH 744 CG10021-PH 230..285 18..74 201 61.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 01:28:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23833-PA 81 GI23833-PA 1..81 1..81 428 100 Plus
Dmoj\GI17766-PA 464 GI17766-PA 278..330 21..74 195 64.8 Plus
Dmoj\GI23940-PA 752 GI23940-PA 225..280 18..74 194 61.4 Plus
Dmoj\GI17769-PA 648 GI17769-PA 454..506 21..74 186 61.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 01:28:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18663-PA 81 GL18663-PA 1..81 1..81 428 100 Plus
Dper\GL18676-PA 757 GL18676-PA 221..276 18..74 197 61.4 Plus
Dper\GL19470-PA 654 GL19470-PA 453..505 21..74 183 61.1 Plus
Dper\GL19469-PA 397 GL19469-PA 243..282 34..74 135 61 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 01:28:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10010-PA 81 GA10010-PA 1..81 1..81 428 100 Plus
Dpse\GA10014-PA 754 GA10014-PA 223..278 18..74 199 61.4 Plus
Dpse\GA17731-PA 426 GA17731-PA 235..287 21..74 186 64.8 Plus
Dpse\GA25976-PA 600 GA25976-PA 399..451 21..74 183 61.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 01:28:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18422-PA 81 GM18422-PA 1..81 1..81 428 100 Plus
Dsec\GM18135-PA 389 GM18135-PA 212..264 21..74 197 64.8 Plus
Dsec\GM18435-PA 504 GM18435-PA 230..285 18..74 187 61.4 Plus
Dsec\GM18136-PA 580 GM18136-PA 392..444 21..74 180 61.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 01:28:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23242-PA 81 GD23242-PA 1..81 1..81 428 100 Plus
Dsim\GD23254-PA 1439 GD23254-PA 230..285 18..74 199 61.4 Plus
Dsim\GD22743-PA 391 GD22743-PA 214..266 21..74 197 64.8 Plus
Dsim\GD22744-PA 576 GD22744-PA 388..440 21..74 179 61.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 01:28:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21080-PA 81 GJ21080-PA 1..81 1..81 428 100 Plus
Dvir\GJ21213-PA 775 GJ21213-PA 231..286 18..74 194 61.4 Plus
Dvir\GJ17592-PA 423 GJ17592-PA 238..290 21..74 187 64.8 Plus
Dvir\GJ17594-PA 654 GJ17594-PA 460..512 21..74 187 61.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 01:28:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14638-PA 81 GK14638-PA 1..81 1..81 428 100 Plus
Dwil\GK14650-PA 794 GK14650-PA 237..292 18..74 195 61.4 Plus
Dwil\GK15478-PA 565 GK15478-PA 364..416 21..74 187 61.1 Plus
Dwil\GK15475-PA 416 GK15475-PA 225..277 21..74 186 64.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 01:28:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18245-PA 81 GE18245-PA 1..81 1..81 428 100 Plus
Dyak\GE18258-PA 745 GE18258-PA 230..285 18..74 199 61.4 Plus
Dyak\GE14830-PA 395 GE14830-PA 217..269 21..74 186 64.8 Plus
Dyak\GE14841-PA 585 GE14841-PA 397..449 21..74 181 61.1 Plus

LD26791.hyp Sequence

Translation from 1247 to 1501

> LD26791.hyp
MLRSGVGFQSIRLSGLYNALATPPSTADKHTYADVAQAQHNSSSCSNGNG
CNSCNAHCNSSLHIFNNISRNLHMDTCGRGCFGK*
Sequence LD26791.hyp has no blast hits.