Clone LD27480 Report

Search the DGRC for LD27480

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:274
Well:80
Vector:pOT2
Associated Gene/TranscriptUbc4-RA
Protein status:LD27480.pep: gold
Preliminary Size:2077
Sequenced Size:1491

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8284 2001-01-01 Release 2 assignment
CG8284 2001-09-19 Blastp of sequenced clone
CG8284 2003-01-01 Sim4 clustering to Release 3
UbcD4 2008-04-29 Release 5.5 accounting
UbcD4 2008-08-15 Release 5.9 accounting
UbcD4 2008-12-18 5.12 accounting

Clone Sequence Records

LD27480.complete Sequence

1491 bp (1491 high quality bases) assembled on 2001-09-19

GenBank Submission: AY060381

> LD27480.complete
AAAAAAGAAATAGCGCTGGCAAAATAGACGTGCTGAGCGCTGTAAAAAGT
CAGATTCGTGTTGAAATTGGAATAATAAGTTTTTTATTTTCCGTGCGCTG
GTCGAGCTCGTTGCTTCGACAATTCGAAAAGCGATCGAAAGGAGCAACCT
TGTAGGCCAACAGCCAGGCGTAATTTACGCAACGCACAACACTCACAAAA
TCCAAAATTGCACGGGGGGGCAACAATAAAAACAGAGGCAGAACAGAACA
CAGCAAGAAGAGCGTGGTGAAGAGGAGCGGCGGAGAAAGGAGAACGGTGA
ACAGGGAACAGGGAGAGAGCAGAAAGGAGAGTCCGAGAAACGGAGGAAAC
ATCATGGCGAACATGGCAGTGTCGCGGATCAAGCGGGAGTTCAAGGAGGT
GATGCGCAGCGAGGAGATCGTCCAGTGTTCCATCAAAATCGAACTGGTCA
ATGACAGTTGGACGGAGCTGCGCGGCGAGATCGCCGGTCCGCCTGACACG
CCCTACGAGGGCGGCAAGTTCGTCCTGGAGATCAAGGTGCCCGAGACATA
TCCCTTCAATCCACCAAAGGTACGCTTCATAACGCGCATCTGGCATCCGA
ATATATCGTCGGTTACGGGTGCGATTTGCTTGGACATCTTAAAGGACAAC
TGGGCTGCAGCGATGACACTGCGCACCGTACTGCTGTCGCTGCAGGCGCT
CCTGGCCGCCGCAGAGCCGGACGATCCACAGGACGCAGTGGTGGCCTATC
AGTTTAAGGACAAGTACGATCTGTTCCTGCTTACGGCCAAGCACTGGACC
AACGCGTATGCGGGCGGACCGCACACCTTTCCCGATTGTGATTCAAAGAT
CCAACGTCTCAGGGACATGGGCATCGACGAGCATGAGGCGCGCGCCGTGC
TCTCCAAGGAGAATTGGAATTTGGAGAAGGCCACCGAGGGCCTGTTCAGT
TAGCTTGTCCCAGCCGCACTAGCATCAGTACCATTCGCGGCGGTGGCAGC
ACCAAGAACACCGGCCAACTTCAGCATCAATCCTTCAGAACGGCAATCAC
GCTAAATTCTTGTACACTCACGCACCAATATATTTTCGTAAATCTTATCC
ACGAAATTACATTGCCCTGTAGTTATAATAATTCTCTGATCTGTTCTATA
ATTTTATTATGATTAATGTGCACATCTTTGCCGCTGGGTGGGTCACCAGA
AGGTTGAGCCAAAGGCCATGCCCGCGCCCCATTGAGCATGTGGTGTTATG
TAATTGAACCCAGGTTCTGTTTCATTAATTTACGTGCAGTCGCATTTACT
TGCAGGCTCTTTCTTAAACAGTACTGTTGTTTTCCATTTCAAGCTTAAAC
TAAAACACAAACAAAAATGATTTACAAAACAAAATAAATGTGAAGGCGAG
GAGTGTATAACAAATCGAAGTCTTTGTAAATTGCGTTAAGTTAATAAATA
AATAAATAAAAATATTAATAAAAAAAAAAAAAAAAAAAAAA

LD27480.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:19:25
Subject Length Description Subject Range Query Range Score Percent Strand
UbcD4-RA 1735 UbcD4-RA 31..1502 1..1472 7360 100 Plus
nc_11709.a 1069 nc_11709.a 534..1069 568..1103 2680 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:06:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9691160..9692061 568..1469 4465 99.7 Plus
chr3L 24539361 chr3L 9690156..9690571 1..416 2080 100 Plus
chr3L 24539361 chr3L 9690780..9690939 415..574 800 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:06:21
Subject Length Description Subject Range Query Range Score Percent Strand
Ubc4-RC 600 CG8284-PC 1..600 354..953 3000 100 Plus
Ubc4-RB 600 CG8284-PB 1..600 354..953 3000 100 Plus
Ubc4-RA 600 CG8284-PA 1..600 354..953 3000 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:19:41 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:06:19
Subject Length Description Subject Range Query Range Score Percent Strand
Ubc4-RC 1709 CG8284-RC 5..1473 1..1469 7345 100 Plus
Ubc4-RB 1473 CG8284-RB 5..1473 1..1469 7345 100 Plus
Ubc4-RA 1107 CG8284-RA 5..1107 1..1103 5515 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:06:23
Subject Length Description Subject Range Query Range Score Percent Strand
Ubc4-PC 199 CG8284-PC 1..196 354..941 979 100 Plus
Ubc4-PB 199 CG8284-PB 1..196 354..941 979 100 Plus
Ubc4-PA 199 CG8284-PA 1..196 354..941 979 100 Plus
eff-PC 147 CG7425-PC 1..146 363..812 280 44.7 Plus
eff-PB 147 CG7425-PB 1..146 363..812 280 44.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:06:17
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9699344..9700248 568..1472 4525 100 Plus
3L 28110227 3L 9698340..9698755 1..416 2080 100 Plus
3L 28110227 3L 9698964..9699123 415..574 800 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:42:32
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 9692444..9693348 568..1472 4525 100 Plus
3L 28103327 3L 9691440..9691855 1..416 2080 100 Plus
3L 28103327 3L 9692064..9692223 415..574 800 100 Plus
Blast to na_te.dros performed on 2014-11-27 03:06:18 has no hits.

LD27480.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:06:24 Download gff for LD27480.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9691162..9692034 570..1442 99   Plus
chr3L 9690782..9690934 417..569 100 -> Plus
chr3L 9690156..9690571 1..416 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:06:45 Download gff for LD27480.complete
Subject Subject Range Query Range Percent Splice Strand
UbcD4-RA 1..600 354..953 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:02:28 Download gff for LD27480.complete
Subject Subject Range Query Range Percent Splice Strand
UbcD4-RA 1..600 354..953 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:35:56 Download gff for LD27480.complete
Subject Subject Range Query Range Percent Splice Strand
UbcD4-RA 1..600 354..953 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:32:59 Download gff for LD27480.complete
Subject Subject Range Query Range Percent Splice Strand
UbcD4-RA 1..600 354..953 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:06:24 Download gff for LD27480.complete
Subject Subject Range Query Range Percent Splice Strand
Ubc4-RA 1..600 354..953 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:50:47 Download gff for LD27480.complete
Subject Subject Range Query Range Percent Splice Strand
UbcD4-RA 1..1447 3..1449 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:02:28 Download gff for LD27480.complete
Subject Subject Range Query Range Percent Splice Strand
UbcD4-RA 1..1447 3..1449 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:35:56 Download gff for LD27480.complete
Subject Subject Range Query Range Percent Splice Strand
UbcD4-RA 5..1107 1..1103 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:32:59 Download gff for LD27480.complete
Subject Subject Range Query Range Percent Splice Strand
UbcD4-RA 1..1447 3..1449 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:06:24 Download gff for LD27480.complete
Subject Subject Range Query Range Percent Splice Strand
Ubc4-RB 5..1453 1..1449 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:06:24 Download gff for LD27480.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9699346..9700225 570..1449 100   Plus
3L 9698966..9699118 417..569 100 -> Plus
3L 9698340..9698755 1..416 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:35:56 Download gff for LD27480.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9692446..9693325 570..1449 100   Plus
arm_3L 9692066..9692218 417..569 100 -> Plus
arm_3L 9691440..9691855 1..416 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:09:43 Download gff for LD27480.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9692446..9693325 570..1449 100   Plus
3L 9692066..9692218 417..569 100 -> Plus
3L 9691440..9691855 1..416 100 -> Plus

LD27480.pep Sequence

Translation from 353 to 952

> LD27480.pep
MANMAVSRIKREFKEVMRSEEIVQCSIKIELVNDSWTELRGEIAGPPDTP
YEGGKFVLEIKVPETYPFNPPKVRFITRIWHPNISSVTGAICLDILKDNW
AAAMTLRTVLLSLQALLAAAEPDDPQDAVVAYQFKDKYDLFLLTAKHWTN
AYAGGPHTFPDCDSKIQRLRDMGIDEHEARAVLSKENWNLEKATEGLFS*

LD27480.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 04:14:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25155-PA 199 GF25155-PA 1..199 1..199 987 98 Plus
Dana\GF18131-PA 147 GF18131-PA 1..146 4..153 318 44.7 Plus
Dana\GF10262-PA 350 GF10262-PA 180..324 5..153 317 43 Plus
Dana\GF19231-PA 151 GF19231-PA 39..148 43..153 299 52.3 Plus
Dana\GF19392-PA 272 GF19392-PA 82..228 3..153 297 40.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 04:14:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15402-PA 199 GG15402-PA 1..199 1..199 1067 99.5 Plus
Dere\GG21088-PA 147 GG21088-PA 1..146 4..153 318 44.7 Plus
Dere\GG24249-PA 151 GG24249-PA 39..150 43..155 303 54 Plus
Dere\GG17819-PA 151 GG17819-PA 39..148 43..153 299 52.3 Plus
Dere\GG14251-PA 406 GG14251-PA 259..404 4..153 286 39.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 04:14:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16318-PA 199 GH16318-PA 1..199 1..199 973 95.5 Plus
Dgri\GH14086-PA 147 GH14086-PA 1..146 4..153 318 44.7 Plus
Dgri\GH22592-PA 151 GH22592-PA 39..148 43..153 303 53.2 Plus
Dgri\GH17677-PA 151 GH17677-PA 39..148 43..153 299 52.3 Plus
Dgri\GH13340-PA 240 GH13340-PA 95..239 5..153 272 42.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 04:14:43
Subject Length Description Subject Range Query Range Score Percent Strand
Ubc4-PC 199 CG8284-PC 1..199 1..199 1049 100 Plus
Ubc4-PB 199 CG8284-PB 1..199 1..199 1049 100 Plus
Ubc4-PA 199 CG8284-PA 1..199 1..199 1049 100 Plus
eff-PC 147 CG7425-PC 1..146 4..153 308 44.7 Plus
eff-PB 147 CG7425-PB 1..146 4..153 308 44.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 04:14:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13263-PA 199 GI13263-PA 1..199 1..199 973 96.5 Plus
Dmoj\GI14815-PA 199 GI14815-PA 1..198 1..198 795 77.8 Plus
Dmoj\GI10619-PA 147 GI10619-PA 1..146 4..153 318 44.7 Plus
Dmoj\GI22711-PA 151 GI22711-PA 39..148 43..153 303 53.2 Plus
Dmoj\GI21493-PA 151 GI21493-PA 39..148 43..153 298 52.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 04:14:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12716-PA 199 GL12716-PA 1..199 1..199 990 97.5 Plus
Dper\GL11784-PA 202 GL11784-PA 1..202 1..199 670 61.9 Plus
Dper\GL26777-PA 211 GL26777-PA 3..204 2..199 488 45.5 Plus
Dper\GL20714-PA 140 GL20714-PA 14..140 72..199 414 68 Plus
Dper\GL23670-PA 147 GL23670-PA 1..146 4..153 318 44.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 04:14:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20954-PA 199 GA20954-PA 1..199 1..199 990 97.5 Plus
Dpse\GA28294-PA 198 GA28294-PA 1..198 1..199 700 68.8 Plus
Dpse\GA23466-PA 202 GA23466-PA 1..202 1..199 660 61.4 Plus
Dpse\GA23052-PA 211 GA23052-PA 3..204 2..199 487 45.5 Plus
Dpse\GA26693-PA 147 GA26693-PA 1..146 4..153 318 44.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 04:14:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25177-PA 199 GM25177-PA 1..199 1..199 1050 98.5 Plus
Dsec\GM25828-PA 147 GM25828-PA 1..146 4..153 318 44.7 Plus
Dsec\GM14046-PA 362 GM14046-PA 216..361 4..153 307 42.7 Plus
Dsec\GM17649-PA 151 GM17649-PA 39..148 43..153 299 52.3 Plus
Dsec\GM16552-PA 151 GM16552-PA 38..148 42..153 289 53.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 04:14:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14207-PA 199 GD14207-PA 1..199 1..199 987 98 Plus
Dsim\GD20402-PA 147 GD20402-PA 1..146 4..153 318 44.7 Plus
Dsim\GD13323-PA 362 GD13323-PA 215..361 3..153 301 41.7 Plus
Dsim\GD17149-PA 151 GD17149-PA 39..148 43..153 299 52.3 Plus
Dsim\GD21999-PA 151 GD21999-PA 38..148 42..153 289 53.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 04:14:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12033-PA 199 GJ12033-PA 1..199 1..199 978 96.5 Plus
Dvir\GJ18969-PA 199 GJ18969-PA 1..198 1..198 831 77.8 Plus
Dvir\GJ19478-PA 199 GJ19478-PA 1..198 1..198 763 73.7 Plus
Dvir\GJ22971-PA 147 GJ22971-PA 1..146 4..153 318 44.7 Plus
Dvir\GJ23435-PA 151 GJ23435-PA 39..148 43..153 303 53.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 04:14:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16629-PA 199 GK16629-PA 1..199 1..199 978 96.5 Plus
Dwil\GK11688-PA 147 GK11688-PA 1..146 4..153 318 44.7 Plus
Dwil\GK21643-PA 151 GK21643-PA 39..148 43..153 312 53.2 Plus
Dwil\GK25846-PA 151 GK25846-PA 39..148 43..153 299 52.3 Plus
Dwil\GK16491-PA 236 GK16491-PA 119..235 40..157 275 44.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 04:14:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20867-PA 199 GE20867-PA 1..199 1..199 1069 100 Plus
Dyak\eff-PA 147 GE26430-PA 1..146 4..153 318 44.7 Plus
Dyak\GE17114-PA 151 GE17114-PA 39..148 43..153 299 52.3 Plus
Dyak\GE24917-PA 151 GE24917-PA 39..150 43..155 296 52.2 Plus
Dyak\GE17550-PA 163 GE17550-PA 18..163 3..152 271 42.7 Plus

LD27480.hyp Sequence

Translation from 353 to 952

> LD27480.hyp
MANMAVSRIKREFKEVMRSEEIVQCSIKIELVNDSWTELRGEIAGPPDTP
YEGGKFVLEIKVPETYPFNPPKVRFITRIWHPNISSVTGAICLDILKDNW
AAAMTLRTVLLSLQALLAAAEPDDPQDAVVAYQFKDKYDLFLLTAKHWTN
AYAGGPHTFPDCDSKIQRLRDMGIDEHEARAVLSKENWNLEKATEGLFS*

LD27480.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:35:08
Subject Length Description Subject Range Query Range Score Percent Strand
Ubc4-PC 199 CG8284-PC 1..199 1..199 1049 100 Plus
Ubc4-PB 199 CG8284-PB 1..199 1..199 1049 100 Plus
Ubc4-PA 199 CG8284-PA 1..199 1..199 1049 100 Plus
eff-PC 147 CG7425-PC 1..146 4..153 308 44.7 Plus
eff-PB 147 CG7425-PB 1..146 4..153 308 44.7 Plus