Clone LD29377 Report

Search the DGRC for LD29377

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:293
Well:77
Vector:pOT2
Associated Gene/TranscriptUbcE2M-RA
Protein status:LD29377.pep: gold
Preliminary Size:1096
Sequenced Size:904

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7375 2001-01-01 Release 2 assignment
CG7375 2002-05-15 Blastp of sequenced clone
CG7375 2003-01-01 Sim4 clustering to Release 3
CG7375 2008-04-29 Release 5.5 accounting
CG7375 2008-08-15 Release 5.9 accounting
CG7375 2008-12-18 5.12 accounting

Clone Sequence Records

LD29377.complete Sequence

904 bp (904 high quality bases) assembled on 2002-05-15

GenBank Submission: AY118545

> LD29377.complete
AAAGGATAGAAAGCACTCGAAGTGATTTTTTACATCAGTTCTATTGTTAA
CGCAAAAGCCCCCCAGAGAGCCAGAAACTTTCGAGCACAGCCAAACGCGG
AAGACGAAACGCCAGCGAGACGAGGACGCCAAGATGATTAAACTATTCAC
GCTTAAGCAGCAGAAGAAAGACGGCGAGCAAAAGGGCAGTCAGCAGAAGA
AAGCGTCCGCCGCCCAGCTGCGCATACAGAAAGATATTAACGAACTGAAC
CTGCCAAACACTTGCGCCACAGACTTTCCCGATCCCAATGACTTGCTCAA
CTTCAAGCTTATCATCTCGCCCGACGAGGGCTTCTACAGAGACGGGCGCT
TCGTGTTCAATTTCCGCGTCGGATCCAACTATCCGCACGAGCCGCCCAAG
GTGAAGTGCGCCACCCAGGTGTACCATCCCAATATTGACCTGGATGGCAA
CGTCTGCCTCAACATTCTGCGCGAGGACTGGAATCCAGTGCTGAACATCA
ACTCCATCGTCTATGGCTTGCAGTTTCTATTCTTGGAACCCAATCCCGAG
GATCCGCTCAACAAGGAGGCGGCCGACGTCCTGCAGACCAACCGCCGTCA
GTTCGAGAACAATGTAAAGAAGGCGATGCGTGGTGGCTGTGTGGGCGAGA
CCTACTTCGAGTGCTGTCTGCTCAAGTGATATAGGGAATCGCAAGGTCTC
TTACTTTAAGCCTGTCCATACACCTCCCCCTACACCCGCTAACTGAAGAA
GATGAAGCAAAACACAGACGAACATCGGCGACAACAAATTATTGTAATAA
ACGAAAACAAAATCCACTGCGTGCAAAGAAGAAGCCGAGTCAAGTCACCA
ATTTCTAGTTTTTAATACAATTCATTTAGCAATTTCAAAAAAAAAAAAAA
AAAA

LD29377.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:08:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG7375.b 1438 CG7375.b 158..1043 1..886 4430 100 Plus
CG7375-RA 1131 CG7375-RA 196..1081 1..886 4430 100 Plus
CG7375.c 1738 CG7375.c 158..1043 1..886 4430 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:00:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8188493..8188844 886..535 1760 100 Minus
chr3L 24539361 chr3L 8189101..8189405 536..232 1525 100 Minus
chr3L 24539361 chr3L 8189482..8189663 233..52 910 100 Minus
chr3L 24539361 chr3L 8189739..8189790 52..1 260 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:00:54
Subject Length Description Subject Range Query Range Score Percent Strand
UbcE2M-RC 546 CG7375-PC 1..546 134..679 2730 100 Plus
UbcE2M-RB 546 CG7375-PB 1..546 134..679 2730 100 Plus
UbcE2M-RA 546 CG7375-PA 1..546 134..679 2730 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:22:33 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:00:53
Subject Length Description Subject Range Query Range Score Percent Strand
UbcE2M-RC 1729 CG7375-RC 158..1043 1..886 4430 100 Plus
UbcE2M-RA 913 CG7375-RA 28..913 1..886 4430 100 Plus
UbcE2M-RB 916 CG7375-RB 28..916 1..886 4365 99.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:00:56
Subject Length Description Subject Range Query Range Score Percent Strand
UbcE2M-PC 181 CG7375-PC 1..181 134..676 975 100 Plus
UbcE2M-PB 181 CG7375-PB 1..181 134..676 975 100 Plus
UbcE2M-PA 181 CG7375-PA 1..181 134..676 975 100 Plus
Ubc6-PC 151 CG2013-PC 2..151 203..661 249 31 Plus
Ubc6-PA 151 CG2013-PA 2..151 203..661 249 31 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:00:50
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8196533..8196884 886..535 1760 100 Minus
3L 28110227 3L 8197141..8197445 536..232 1525 100 Minus
3L 28110227 3L 8197522..8197703 233..52 910 100 Minus
3L 28110227 3L 8197779..8197830 52..1 260 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:38:59
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8189633..8189984 886..535 1760 100 Minus
3L 28103327 3L 8190241..8190545 536..232 1525 100 Minus
3L 28103327 3L 8190622..8190803 233..52 910 100 Minus
3L 28103327 3L 8190879..8190930 52..1 260 100 Minus
Blast to na_te.dros performed on 2014-11-27 15:00:51 has no hits.

LD29377.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:03:57 Download gff for LD29377.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8189739..8189790 1..52 100   Minus
chr3L 8189482..8189662 53..233 100 <- Minus
chr3L 8189102..8189403 234..535 100 <- Minus
chr3L 8188493..8188843 536..886 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:09:45 Download gff for LD29377.complete
Subject Subject Range Query Range Percent Splice Strand
CG7375-RA 1..546 134..679 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:51:19 Download gff for LD29377.complete
Subject Subject Range Query Range Percent Splice Strand
CG7375-RA 1..546 134..679 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:23:10 Download gff for LD29377.complete
Subject Subject Range Query Range Percent Splice Strand
Ubc12-RA 1..546 134..679 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:43:56 Download gff for LD29377.complete
Subject Subject Range Query Range Percent Splice Strand
CG7375-RA 1..546 134..679 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:03:57 Download gff for LD29377.complete
Subject Subject Range Query Range Percent Splice Strand
UbcE2M-RA 1..546 134..679 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:29:05 Download gff for LD29377.complete
Subject Subject Range Query Range Percent Splice Strand
CG7375-RA 27..912 1..886 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:51:19 Download gff for LD29377.complete
Subject Subject Range Query Range Percent Splice Strand
CG7375-RA 27..912 1..886 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:23:10 Download gff for LD29377.complete
Subject Subject Range Query Range Percent Splice Strand
Ubc12-RA 28..913 1..886 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:43:56 Download gff for LD29377.complete
Subject Subject Range Query Range Percent Splice Strand
CG7375-RA 27..912 1..886 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:03:57 Download gff for LD29377.complete
Subject Subject Range Query Range Percent Splice Strand
UbcE2M-RA 28..913 1..886 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:03:57 Download gff for LD29377.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8197779..8197830 1..52 100   Minus
3L 8197522..8197702 53..233 100 <- Minus
3L 8197142..8197443 234..535 100 <- Minus
3L 8196533..8196883 536..886 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:23:10 Download gff for LD29377.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8190879..8190930 1..52 100   Minus
arm_3L 8190622..8190802 53..233 100 <- Minus
arm_3L 8190242..8190543 234..535 100 <- Minus
arm_3L 8189633..8189983 536..886 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:16:14 Download gff for LD29377.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8190879..8190930 1..52 100   Minus
3L 8190622..8190802 53..233 100 <- Minus
3L 8190242..8190543 234..535 100 <- Minus
3L 8189633..8189983 536..886 100 <- Minus

LD29377.pep Sequence

Translation from 133 to 678

> LD29377.pep
MIKLFTLKQQKKDGEQKGSQQKKASAAQLRIQKDINELNLPNTCATDFPD
PNDLLNFKLIISPDEGFYRDGRFVFNFRVGSNYPHEPPKVKCATQVYHPN
IDLDGNVCLNILREDWNPVLNINSIVYGLQFLFLEPNPEDPLNKEAADVL
QTNRRQFENNVKKAMRGGCVGETYFECCLLK*

LD29377.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 21:52:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24700-PA 183 GF24700-PA 1..183 1..181 886 92.9 Plus
Dana\GF16080-PA 151 GF16080-PA 2..151 24..176 248 31 Plus
Dana\GF18131-PA 147 GF18131-PA 5..143 30..166 243 34.3 Plus
Dana\GF19231-PA 151 GF19231-PA 26..149 48..170 219 33.1 Plus
Dana\GF19392-PA 272 GF19392-PA 86..217 29..158 216 31.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 21:52:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15103-PA 181 GG15103-PA 1..181 1..181 947 98.3 Plus
Dere\GG11277-PA 151 GG11277-PA 2..151 24..176 248 31 Plus
Dere\GG21088-PA 147 GG21088-PA 5..143 30..166 243 34.3 Plus
Dere\GG17717-PA 241 GG17717-PA 58..213 10..163 237 29.3 Plus
Dere\GG17819-PA 151 GG17819-PA 26..149 48..170 220 33.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 21:52:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15981-PA 181 GH15981-PA 1..180 1..179 878 91.1 Plus
Dgri\GH15302-PA 151 GH15302-PA 2..151 24..176 248 31 Plus
Dgri\GH14086-PA 147 GH14086-PA 5..143 30..166 243 34.3 Plus
Dgri\GH17677-PA 151 GH17677-PA 26..149 48..170 218 33.1 Plus
Dgri\GH22592-PA 151 GH22592-PA 26..149 48..170 218 32.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 21:52:25
Subject Length Description Subject Range Query Range Score Percent Strand
UbcE2M-PC 181 CG7375-PC 1..181 1..181 975 100 Plus
UbcE2M-PB 181 CG7375-PB 1..181 1..181 975 100 Plus
UbcE2M-PA 181 CG7375-PA 1..181 1..181 975 100 Plus
Ubc6-PC 151 CG2013-PC 2..151 24..176 249 31 Plus
Ubc6-PA 151 CG2013-PA 2..151 24..176 249 31 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 21:52:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16632-PA 182 GI16632-PA 1..181 1..179 875 90.6 Plus
Dmoj\GI22506-PA 151 GI22506-PA 2..151 24..176 248 31 Plus
Dmoj\GI10619-PA 147 GI10619-PA 5..143 30..166 243 34.3 Plus
Dmoj\GI21620-PA 382 GI21620-PA 122..253 29..158 228 35.3 Plus
Dmoj\GI21493-PA 151 GI21493-PA 2..149 25..170 224 32.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 21:52:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22563-PA 183 GL22563-PA 1..183 1..181 900 92.9 Plus
Dper\GL22213-PA 151 GL22213-PA 2..151 24..176 248 31 Plus
Dper\GL23670-PA 147 GL23670-PA 5..143 30..166 243 34.3 Plus
Dper\GL14825-PA 151 GL14825-PA 26..149 48..170 220 33.1 Plus
Dper\GL26387-PA 228 GL26387-PA 65..216 9..158 207 30.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 21:52:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20305-PA 183 GA20305-PA 1..183 1..181 900 92.9 Plus
Dpse\GA15184-PA 151 GA15184-PA 2..151 24..176 248 31 Plus
Dpse\GA26693-PA 147 GA26693-PA 5..143 30..166 243 34.3 Plus
Dpse\GA15184-PB 118 GA15184-PB 6..118 59..176 232 33.9 Plus
Dpse\GA15395-PA 216 GA15395-PA 17..169 14..158 231 32 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 21:52:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24960-PA 181 GM24960-PA 1..181 1..181 958 100 Plus
Dsec\GM10669-PA 151 GM10669-PA 2..151 24..176 248 31 Plus
Dsec\GM25828-PA 147 GM25828-PA 5..143 30..166 243 34.3 Plus
Dsec\GM11560-PA 237 GM11560-PA 63..194 29..158 224 33.1 Plus
Dsec\GM17649-PA 151 GM17649-PA 26..149 48..170 220 33.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 21:52:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13010-PA 166 GD13010-PA 1..166 1..181 706 82.9 Plus
Dsim\GD19645-PA 151 GD19645-PA 2..151 24..176 248 31 Plus
Dsim\GD20402-PA 147 GD20402-PA 5..143 30..166 243 34.3 Plus
Dsim\GD17077-PA 237 GD17077-PA 63..194 29..158 223 33.1 Plus
Dsim\GD17149-PA 151 GD17149-PA 26..149 48..170 220 33.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 21:52:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12887-PA 182 GJ12887-PA 1..181 1..179 880 91.7 Plus
Dvir\GJ10109-PA 151 GJ10109-PA 2..151 24..176 248 31 Plus
Dvir\GJ22971-PA 147 GJ22971-PA 5..143 30..166 243 34.3 Plus
Dvir\GJ16559-PA 312 GJ16559-PA 98..229 29..158 225 35.3 Plus
Dvir\GJ19035-PA 151 GJ19035-PA 7..149 30..170 224 32.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 21:52:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10814-PA 183 GK10814-PA 1..183 1..181 858 88.5 Plus
Dwil\GK14053-PA 151 GK14053-PA 2..151 24..176 248 31 Plus
Dwil\GK11688-PA 147 GK11688-PA 5..143 30..166 243 34.3 Plus
Dwil\GK25846-PA 151 GK25846-PA 26..149 48..170 220 33.1 Plus
Dwil\GK21643-PA 151 GK21643-PA 27..142 49..163 212 32.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 21:52:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21328-PA 181 GE21328-PA 1..181 1..181 947 98.3 Plus
Dyak\GE25319-PA 151 GE25319-PA 2..151 24..176 248 31 Plus
Dyak\eff-PA 147 GE26430-PA 5..143 30..166 243 34.3 Plus
Dyak\GE17005-PA 248 GE17005-PA 74..205 29..158 226 33.1 Plus
Dyak\GE17114-PA 151 GE17114-PA 26..149 48..170 220 33.1 Plus

LD29377.hyp Sequence

Translation from 133 to 678

> LD29377.hyp
MIKLFTLKQQKKDGEQKGSQQKKASAAQLRIQKDINELNLPNTCATDFPD
PNDLLNFKLIISPDEGFYRDGRFVFNFRVGSNYPHEPPKVKCATQVYHPN
IDLDGNVCLNILREDWNPVLNINSIVYGLQFLFLEPNPEDPLNKEAADVL
QTNRRQFENNVKKAMRGGCVGETYFECCLLK*

LD29377.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:18:23
Subject Length Description Subject Range Query Range Score Percent Strand
UbcE2M-PC 181 CG7375-PC 1..181 1..181 975 100 Plus
UbcE2M-PB 181 CG7375-PB 1..181 1..181 975 100 Plus
UbcE2M-PA 181 CG7375-PA 1..181 1..181 975 100 Plus
Ubc6-PC 151 CG2013-PC 2..151 24..176 249 31 Plus
Ubc6-PA 151 CG2013-PA 2..151 24..176 249 31 Plus