Clone LD29596 Report

Search the DGRC for LD29596

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:295
Well:96
Vector:pOT2
Associated Gene/Transcriptcad-RA
Protein status:LD29596.pep: gold
Preliminary Size:2500
Sequenced Size:2518

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1759 2001-01-01 Release 2 assignment
CG1759 2001-11-29 Blastp of sequenced clone
CG1759 2003-01-01 Sim4 clustering to Release 3
cad 2008-04-29 Release 5.5 accounting
cad 2008-08-15 Release 5.9 accounting
cad 2008-12-18 5.12 accounting

Clone Sequence Records

LD29596.complete Sequence

2518 bp (2518 high quality bases) assembled on 2001-11-29

GenBank Submission: AY069565

> LD29596.complete
CTGAGTTGACGTCGCCACGCACGGAATAACATTTCAAATTAGTAGATTAG
CCCTGCAAAACAAAAATCCATCTCGTGAGTGAGTGCTGAAAAATAGCGTT
TCGAAATATTATCGATATCTCGGTCGTATGTTACTGTGCTCCCAAAAAAC
ACATCACCAGCCAGTGATAACTGTAAAGATTGACAAAGCAAAATATATCC
ATTATAACCCAAACTGAAACTCCAGAAAATGTGCAACTAAAACATATTGG
CCATCAAAGTGATAAGACTTAGAGATTAACGCCGGATTATTGGACACCGG
ACCGAGCACTGGGACTATCTTCGGAGAAAGCGCACCTAATCTAACCTCAA
AATGGTTTCGCACTACTACAACACACTGCCCTACACACAAAAGCACAGTG
CCGCCAATTTGGCCTATGCCTCAGCGGCGGGCCAGCCATGGAACTGGACG
CCCAACTACCACCACACGCCGCCGAACCACCAGTTCCTGGGCGATGTGGA
CTCCTCGCATGCCGCCCACCACGCGGCCGCTGCCCACCAGATGTACTACA
ACTCCCATCACATGTTCCACTCGGCGGCGGCGGCCTCTGCCGGGGAGTGG
CACTCACCCGCCTCGAGCACGGCGGATAACTTCGTTCAGAATGTGCCCAC
GTCGGCCCACCAGCTGATGCAGCAGCACCACCATCATCACGCCCATGCCT
CCAGCAGTTCCGCCAGTTCCGGGAGCAGCAGTAGCGGTGGTGCACCGGGT
GCGCCCCAGCTCAACGAGACCAACAGCAGCATCGGCGTCGGAGGAGCAGG
CGGTGGCGGTGGTGTTGGCGGGGCCACCGATGGAGGACCAGGTTCCGCAC
CACCCAACCATCAGCAGCACATCGCCGAAGGTCTGCCGTCGCCACCGATT
ACCGTTTCGGGCTCGGAAATCTCTAGCCCGGGGGCGCCGACTTCTGCCTC
GTCGCCGCATCATCACTTGGCACACCATTTGAGTGCCGTCGCCAACAACA
ACAACAACAACAACAACAACAACAATAGCCCATCCACCCATAACAACAAC
AACAATAACAATTCGGTGAGCAACAACAACAGGACATCGCCATCGAAGCC
GCCATACTTCGACTGGATGAAGAAGCCCGCCTATCCAGCACAACCACAAC
CAGGCAAAACCCGCACCAAGGATAAGTACCGCGTGGTGTACACCGACTTC
CAGCGCCTGGAGCTGGAGAAGGAGTACTGCACCTCCCGCTACATCACCAT
CCGGCGGAAGAGCGAGCTCGCCCAGACGCTGTCGCTGTCGGAGCGCCAGG
TTAAGATCTGGTTCCAGAACCGCCGCGCCAAGGAGCGCAAGCAGAACAAG
AAGGGTAGCGATCCGAACGTGATGGGCGTGGGAGTGCAGCATGCGGACTA
CAGCCAGCTGCTGGACGCCAAAGCGAAGCTGGAGCCGGGCCTGCACCTGT
CCCACTCGCTGGCCCACTCGATGAACCCCATGGCGGCGATGAACATTCCC
GCCATGCGCCTGCATCCCCACCTGGCCGCCCACAGCCACTCCTTGGCGGC
GGTGGCGGCGCACTCACACCAGCTGCAGCAGCAGCACAGTGCGCAGATGT
CCGCTGCGGCGGCAGTGGGCACGCTCTCGATGTGACACGACCATTCCTGT
TATGCGGCGAGCGGCGACAGTAACAACTACATGGAGCCCCATCATCCGCT
GCTGGGTGGTAGCGAGCGGGGTGGAGTAGGAGGCGTAGGAGGCGTAGGAG
GAGGAGGCGGACAACCGTGCGATGTGTCCTTCAGTGCTCCCGCTCTCGCC
TTGGACTTGGCTTAACCCTTAGGTCGCGCAGTCAGACTGTTTCGACCGAA
CCGAAAAGTTAATAGGCAGCCGGACGAATGGAGGACTTGGCGGCCGTTGC
ACCTGGAATATTGCACGTTGTTAATTTTTGTGATTGTATATTCCTGGTTT
CGACACGCGCCAGAGTCCTCACAGCTAAACAAGTCTTATATTATTCTTGT
ATTATGTTTGTTTTTTGTTCAACGTGTGTAGTAGCTTAAAGTAAAATGAA
TAGCTCGTAAGCAGTAGTAAGTAAAGTTGCCCGAGAAAAACAAGAACAAT
TCAAACCAGCCGTCCCAGCCGATTAACGTTTAAAAGTACTCGCTGCAGTT
AAACATAATTTTAGTACAAGCAACTCATTTTAGAGCGCAACTTGATTCTT
CAGCCCGTGTAAATAGCCGCATATATAAAGAGTTTTAACGTTTATTACTT
TTATGTATCGTAATAACAATTAGCCGTAGTTAATATAGCCGTACTAAATG
TTAAATGTAACGCACTCTTCGAGCACACAAGCAAAATTACCATTTAAATA
AATAATTTTAACGTATTCACCCGCATCTTTACTTAGTTCAATTTGGCGGC
AATTAATTTATAACTTGTGAATGTGTACGTGTGTATATGTATGTGCATAG
CTATTTAAATAAAATATGAACACCATAGATAAAGCAACTCAAAAAAAAAA
AAAAAAAAAAAAAAAAAA

LD29596.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:55:03
Subject Length Description Subject Range Query Range Score Percent Strand
cad-RB 2535 cad-RB 39..2530 1..2492 12460 100 Plus
cad-RA 2579 cad-RA 41..2532 1..2492 12460 100 Plus
cad.a 2573 cad.a 1229..2568 1153..2492 6700 100 Plus
cad.a 2573 cad.a 23..1175 1..1153 5765 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:16:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 20780288..20781626 1151..2490 6635 99.9 Plus
chr2L 23010047 chr2L 20769262..20770416 1..1154 5635 99.4 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:16:14
Subject Length Description Subject Range Query Range Score Percent Strand
cad-RB 1284 CG1759-PB 1..1284 352..1635 6420 100 Plus
cad-RA 1284 CG1759-PA 1..1284 352..1635 6420 100 Plus
cad-RC 1338 CG1759-PC 1..802 352..1153 4010 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:22:53 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:16:13
Subject Length Description Subject Range Query Range Score Percent Strand
cad-RA 2516 CG1759-RA 27..2516 1..2490 12450 100 Plus
cad-RB 2353 CG1759-RB 1..2353 138..2490 11765 100 Plus
cad-RC 2570 CG1759-RC 1233..2570 1153..2490 6690 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:16:17
Subject Length Description Subject Range Query Range Score Percent Strand
cad-PB 427 CG1759-PB 1..373 352..1470 1187 100 Plus
cad-PA 427 CG1759-PA 1..373 352..1470 1187 100 Plus
cad-PC 445 CG1759-PC 1..391 352..1470 1158 95.4 Plus
Antp-PF 365 CG1028-PF 253..355 1084..1383 214 46.6 Plus
Antp-PE 365 CG1028-PE 253..355 1084..1383 214 46.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:16:10
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20781796..20783137 1151..2492 6710 100 Plus
2L 23513712 2L 20770757..20771910 1..1154 5770 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:20:33
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20781796..20783137 1151..2492 6710 100 Plus
2L 23513712 2L 20770757..20771910 1..1154 5770 100 Plus
Blast to na_te.dros performed 2014-11-26 19:16:11
Subject Length Description Subject Range Query Range Score Percent Strand
297 6995 297 DMIS297 6995bp Derived from X03431 (g8146) (Rel. 36, Last updated, Version 2). 5081..5139 341..399 124 67.8 Plus

LD29596.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 20:37:12 Download gff for LD29596.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 20780291..20781626 1154..2490 99   Plus
chr2L 20769262..20770415 1..1153 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:02:40 Download gff for LD29596.complete
Subject Subject Range Query Range Percent Splice Strand
cad-RB 1..1284 352..1635 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:26:08 Download gff for LD29596.complete
Subject Subject Range Query Range Percent Splice Strand
cad-RB 1..1284 352..1635 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 22:08:34 Download gff for LD29596.complete
Subject Subject Range Query Range Percent Splice Strand
cad-RA 1..1284 352..1635 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:53:26 Download gff for LD29596.complete
Subject Subject Range Query Range Percent Splice Strand
cad-RB 1..1284 352..1635 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:37:12 Download gff for LD29596.complete
Subject Subject Range Query Range Percent Splice Strand
cad-RA 1..1284 352..1635 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:02:39 Download gff for LD29596.complete
Subject Subject Range Query Range Percent Splice Strand
cad-RA 23..2512 1..2490 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:26:08 Download gff for LD29596.complete
Subject Subject Range Query Range Percent Splice Strand
cad-RA 22..2511 1..2490 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 22:08:34 Download gff for LD29596.complete
Subject Subject Range Query Range Percent Splice Strand
cad-RA 27..2516 1..2490 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:53:26 Download gff for LD29596.complete
Subject Subject Range Query Range Percent Splice Strand
cad-RA 23..2512 1..2490 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:37:12 Download gff for LD29596.complete
Subject Subject Range Query Range Percent Splice Strand
cad-RA 27..2516 1..2490 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 20:37:12 Download gff for LD29596.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20781799..20783135 1154..2490 100   Plus
2L 20770757..20771909 1..1153 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 22:08:34 Download gff for LD29596.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20781799..20783135 1154..2490 100   Plus
arm_2L 20770757..20771909 1..1153 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:29:34 Download gff for LD29596.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20781799..20783135 1154..2490 100   Plus
2L 20770757..20771909 1..1153 100 -> Plus

LD29596.pep Sequence

Translation from 351 to 1634

> LD29596.pep
MVSHYYNTLPYTQKHSAANLAYASAAGQPWNWTPNYHHTPPNHQFLGDVD
SSHAAHHAAAAHQMYYNSHHMFHSAAAASAGEWHSPASSTADNFVQNVPT
SAHQLMQQHHHHHAHASSSSASSGSSSSGGAPGAPQLNETNSSIGVGGAG
GGGGVGGATDGGPGSAPPNHQQHIAEGLPSPPITVSGSEISSPGAPTSAS
SPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNNNSVSNNNRTSPSKP
PYFDWMKKPAYPAQPQPGKTRTKDKYRVVYTDFQRLELEKEYCTSRYITI
RRKSELAQTLSLSERQVKIWFQNRRAKERKQNKKGSDPNVMGVGVQHADY
SQLLDAKAKLEPGLHLSHSLAHSMNPMAAMNIPAMRLHPHLAAHSHSLAA
VAAHSHQLQQQHSAQMSAAAAVGTLSM*

LD29596.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 01:58:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15355-PA 440 GF15355-PA 1..440 1..427 1284 75.8 Plus
Dana\GF17789-PA 378 GF17789-PA 277..368 242..344 216 40.8 Plus
Dana\GF17792-PA 582 GF17792-PA 345..434 253..340 206 48.9 Plus
Dana\GF17190-PA 430 GF17190-PA 270..337 277..344 201 54.4 Plus
Dana\GF17790-PA 447 GF17790-PA 276..386 223..336 199 39.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 01:58:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21252-PA 439 GG21252-PA 1..439 1..427 1522 90.6 Plus
Dere\Antp-PA 374 GG10169-PA 273..364 242..344 216 40.8 Plus
Dere\ftz-PA 420 GG13687-PA 264..336 277..354 206 52.6 Plus
Dere\GG13676-PA 579 GG13676-PA 344..433 253..340 205 48.9 Plus
Dere\GG10180-PA 467 GG10180-PA 327..437 223..336 204 40.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 01:58:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11619-PA 442 GH11619-PA 1..442 1..427 1038 62 Plus
Dgri\GH19475-PA 385 GH19475-PA 293..375 251..344 213 42.6 Plus
Dgri\GH19479-PA 599 GH19479-PA 340..429 253..340 205 48.9 Plus
Dgri\GH19477-PA 576 GH19477-PA 286..396 225..336 204 39.3 Plus
Dgri\GH19476-PA 486 GH19476-PA 311..364 277..330 187 61.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:58:09
Subject Length Description Subject Range Query Range Score Percent Strand
cad-PB 427 CG1759-PB 1..427 1..427 2298 100 Plus
cad-PA 427 CG1759-PA 1..427 1..427 2298 100 Plus
cad-PC 445 CG1759-PC 1..445 1..427 2269 96 Plus
Scr-PB 417 CG1030-PB 78..387 58..336 266 28.2 Plus
Scr-PA 417 CG1030-PA 78..387 58..336 266 28.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 01:58:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17922-PA 409 GI17922-PA 1..409 1..427 1153 68.6 Plus
Dmoj\GI24713-PA 378 GI24713-PA 286..368 251..344 213 42.6 Plus
Dmoj\GI24717-PA 592 GI24717-PA 335..424 253..340 206 48.9 Plus
Dmoj\GI24715-PA 418 GI24715-PA 295..388 240..336 203 43.3 Plus
Dmoj\GI23760-PA 651 GI23760-PA 510..579 272..341 188 50 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 01:58:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18519-PA 411 GL18519-PA 1..399 1..417 1269 77.3 Plus
Dper\GL22036-PA 395 GL22036-PA 294..385 242..344 216 40.8 Plus
Dper\GL22041-PA 602 GL22041-PA 341..439 244..340 208 45.5 Plus
Dper\GL21778-PA 471 GL21778-PA 287..356 270..339 198 50 Plus
Dper\GL22053-PA 644 GL22053-PA 511..580 272..341 188 50 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 01:58:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14567-PA 413 GA14567-PA 1..401 1..417 1254 76.9 Plus
Dpse\Antp-PA 392 GA10215-PA 291..382 242..344 216 40.8 Plus
Dpse\Dfd-PA 604 GA15291-PA 341..439 244..340 209 45.5 Plus
Dpse\ftz-PB 467 GA15204-PB 283..352 270..339 197 50 Plus
Dpse\Ubx-PB 360 GA10294-PB 243..323 252..331 193 44.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 01:58:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23368-PA 228 GM23368-PA 1..215 1..215 1059 98.6 Plus
Dsec\GM23369-PA 207 GM23369-PA 1..207 239..427 977 89.4 Plus
Dsec\GM10522-PA 374 GM10522-PA 273..364 242..344 216 40.8 Plus
Dsec\ftz-PA 413 GM10917-PA 261..328 277..344 208 55.9 Plus
Dsec\GM10914-PA 582 GM10914-PA 344..433 253..340 204 46.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 01:58:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24280-PA 440 GD24280-PA 1..440 1..427 1590 91.9 Plus
Dsim\GD19515-PA 374 GD19515-PA 273..364 242..344 216 40.8 Plus
Dsim\ftz-PA 413 GD19897-PA 261..328 277..344 208 55.9 Plus
Dsim\GD19895-PA 582 GD19895-PA 344..433 253..340 205 48.9 Plus
Dsim\GD19518-PA 463 GD19518-PA 325..433 225..336 202 41.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 01:58:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17694-PA 447 GJ17694-PA 1..447 1..427 1149 65.9 Plus
Dvir\Antp-PA 376 GJ23927-PA 284..366 251..344 213 42.6 Plus
Dvir\GJ23932-PA 253 GJ23932-PA 41..112 275..349 195 53.3 Plus
Dvir\GJ23929-PA 303 GJ23929-PA 99..160 275..336 187 54.8 Plus
Dvir\Ubx-PA 378 GJ23925-PA 278..341 268..331 187 51.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 01:58:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14914-PA 415 GK14914-PA 1..415 1..427 1245 74.9 Plus
Dwil\GK10824-PA 374 GK10824-PA 273..364 242..344 216 40.8 Plus
Dwil\GK12253-PA 599 GK12253-PA 353..442 253..340 207 48.9 Plus
Dwil\GK10826-PA 428 GK10826-PA 273..383 225..336 202 39.3 Plus
Dwil\GK10825-PA 430 GK10825-PA 257..339 253..339 193 43.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 01:58:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12346-PA 437 GE12346-PA 1..437 1..427 1487 91 Plus
Dyak\GE25826-PA 375 GE25826-PA 274..365 242..344 216 40.8 Plus
Dyak\GE24883-PA 588 GE24883-PA 349..438 253..340 206 48.9 Plus
Dyak\GE25827-PA 419 GE25827-PA 279..389 225..336 205 40.2 Plus
Dyak\GE24884-PA 421 GE24884-PA 265..337 277..354 201 51.3 Plus

LD29596.hyp Sequence

Translation from 351 to 1634

> LD29596.hyp
MVSHYYNTLPYTQKHSAANLAYASAAGQPWNWTPNYHHTPPNHQFLGDVD
SSHAAHHAAAAHQMYYNSHHMFHSAAAASAGEWHSPASSTADNFVQNVPT
SAHQLMQQHHHHHAHASSSSASSGSSSSGGAPGAPQLNETNSSIGVGGAG
GGGGVGGATDGGPGSAPPNHQQHIAEGLPSPPITVSGSEISSPGAPTSAS
SPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNNNSVSNNNRTSPSKP
PYFDWMKKPAYPAQPQPGKTRTKDKYRVVYTDFQRLELEKEYCTSRYITI
RRKSELAQTLSLSERQVKIWFQNRRAKERKQNKKGSDPNVMGVGVQHADY
SQLLDAKAKLEPGLHLSHSLAHSMNPMAAMNIPAMRLHPHLAAHSHSLAA
VAAHSHQLQQQHSAQMSAAAAVGTLSM*

LD29596.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:19:26
Subject Length Description Subject Range Query Range Score Percent Strand
cad-PB 427 CG1759-PB 1..427 1..427 2298 100 Plus
cad-PA 427 CG1759-PA 1..427 1..427 2298 100 Plus
cad-PC 445 CG1759-PC 1..445 1..427 2269 96 Plus
Scr-PB 417 CG1030-PB 78..387 58..336 266 28.2 Plus
Scr-PA 417 CG1030-PA 78..387 58..336 266 28.2 Plus