Clone LD30065 Report

Search the DGRC for LD30065

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:300
Well:65
Vector:pOT2
Associated Gene/Transcriptl(1)G0232-RC
Protein status:LD30065.pep: gold
Sequenced Size:2783

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
l(1)G0232-RC 2009-06-22 Replacement based on scoring

Clone Sequence Records

LD30065.complete Sequence

2783 bp assembled on 2009-12-14

GenBank Submission: BT120027.1

> LD30065.complete
TAGCTCTACGGTAAAATGGAGGCAGAACAACAAGAATTCGCTGTGAAACA
ATTCATTGATCTCTGCAACAATCTAGGTGCTAACTGCAGCACGACGACAG
CCACATCCCCGTCAACTTCCTCCTCCTCAGCCAGCAGCACGCAGAACTTA
ATAGCAGTAGTGCCGCCACAGTTGCAGCAGCTGCAGGTGCAATTACCGGC
GCCAGGTGGAGGAGGAGGAGCAGGTGCAGGAGGAGGAGGTGGTGGAGGTG
GGGGAGCTGCGCCTGTGAGGCGCCACATCTCGCATACGACAGCCGTGAAG
TTTTTGTACGCCCGTAAATTTGATATACCACGAGCAGTCTCACTGTACGA
ACAGCATGAACAGATCCGCCTGAAGGAGTATCTATATAACATCGATCCGG
ATGTGGAGCCCTTGCGCTCCGAGTTGCAGACCGGCAAGTTCACAATCCTG
CCCGCACGCACTTCCAGTGGCGCTGCCATCGCCCTTTTCACCGCCAATCG
ACACAGTCCGCTGAGCGTTTCGCACACAACCACGCTGCAGGGCATCGTCT
ATCAGCTGGACAGTGCGCTCCAGGATTCGGAGACGCAGCGTGCCGGGCTC
GTTTTTATCTACGACATGAGCGGCTCCAAGTATTCCAACTTCGACTACGA
CCTCTCCCAGAAGATTCTCACACTGCTTAAGGGCGGCTATCCAGCGCGTC
TGAAGAAGGTCCTGATCGTGACGGCGCCACTGTGGTTCAAGGCACCCTTC
AAGATCCTGCGTCTGTTCGTGCGCGAGAAGCTGCGCGAGCGAGTGTTCAC
TGTATCGGTGCCTCAATTGGCGCTGCACGTGCCGCGCAAGGCGCTGCCCA
TTCACTTGGGTGGCACGCTGGAGGTCGATCACGCCACATGGTTGCTCAGC
TGCCGCCAATCGATGACGAATCGTGAGGACGAGCTGCTGGCCAATATCGT
GGGTGTGGGCGGTGGATCCGGATCCGGTTCAGCAGCTGGATCAGCAGCAA
TTGTGTCCACCAATGGCACGGAAACCGAGGCCGCGACAACGGCAGCCACG
ATAATCAGCGCCGTCCACCAGTTGGGCGATAATAATACCACCGTGGTGAC
GGTCAGCAATGGCGTCGGTCCAGCTGGATCGGCATCTGGCGGAGCAACGA
CAGCAGCGTCGGCGGCGACGGAACCCAACGAAAATATCACAATCAACGGA
CTGAGTCCAAGCCACCGTCAGGCGGCGAATAACAGCAGTAGCAGTAGCAG
CAGTGCAGCCACAGTGGCCAATCCCCTCAAGCTCAACACAAGTGGCTCCG
CGGACAACAATAGTACCATCACGAACGCCACCACAGCTGCTGGAGCAGCC
GGAGCAGCTGCTGGCACCACCACCAATGGCGGCGGCGAGTTCTGGTCAGA
GAATCCACCCAGCAGCGCCTCATCCGGCTTCAGTGACGATGATAGTCTCG
CCGGTCAAGAGGGCGATCCCAAGCCCATTGATCAGATTGTTCAGATGGTT
AAGCAGCGCGGACGCCATGGTCTGATTAAGGAGTACGCGGACATTCGGAA
TAGGGCGCCCGAGGGCACCTTTCTGCATGCGAGAATGCGGGCCAATCTGA
CCAAGAATCGCTACACAGACGTCCTCTGCTACGATCACAGTCGAGTTGTT
CTGGCACACGAAGACGGCGACGAGCCGTCGGATTATATTAATGCGAATTT
CGTCGATGGCTACAAACAAAAGAATGCCTATATTTCAACTCAAGGTCCAT
TACCAAAGACATCCCAGGACTTTTGGCGCATGATCTGGGAACAACATTGT
TTAGTTATAGTGATGACGACGCGCGTGATGGAGCGCGGACGCGTGAAATG
CGGCCAGTACTGGGAGCCGACTGAAGAAAGTTCCTTAGAGTTTGGCGACT
ACCATGTGCGAACAATTAGCGTTGAGTGCAACGAGGACTATATGGTTGCC
TCGTTAGAATTGAGAAACATAAAGACTGACGAAATTCGCAATGTCTCACA
TTGGCAGTTCACCAGCTGGCCGGACTATGGCGTTCCCAGCTCGGCCATGG
CCATGCTGAACTTCCTGCAGAAGGTGCGTGAGAAGCAGGCGCAGCTTGTC
CAAGGACTGGGCGACACCTGGGCGGGTCATCCCCGTGGACCGCCCATTGT
GGTGCACTGCAGTGCAGGCATTGGACGCACAGGTACATTCATCACCCTGG
ACATTTGCATATCGCGCCTGGAGGACGTGGGCACGGCGGACATACGTGGA
ACGGTTGAGAAGATCCGGTCGCAGCGAGCCTACTCCATTCAGATGCCCGA
TCAGTACGTGTTCTGTCACCTGGCCCTCATCGAATACGCATATTCGCGTG
GAATGCTACAGACGGTCGATCTGGCTGGCTTCGATGAGCGCGAACCGGAC
TCGGAGTAGGATAATACTACCAACACAGTCCTTGGACCGGAAGAGGGACG
AGAAAACAACGTGTATACAGAATAATTTTATGTTTTACCATTGCAAATTG
GAGTTGTAACTTTCTTCGACTAGATAGATGTTCGTCCTGATATGATATAA
TATGGTATATATGATACGAGAGAAACGATCGGAAGCACAGATAGATTCCG
AGACAAGGAGACACGGACGAGGGAGATGAAATTGTAGAGAGTAGAGTAAA
AAATTTACGTTAATCTATTATTTTTTTTTTTAAATATTATTACACACCAA
GCTATAGTTGTATAGCAAAAACATCTATATATAAACATTATTTAAATTAA
ATTTAAAATGAAAAAAAAAAAAAAAAAAAAAAA

LD30065.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:47:05
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0232.k 3327 l(1)G0232.k 34..2801 1..2769 13790 99.9 Plus
l(1)G0232.j 3806 l(1)G0232.j 34..2801 1..2769 13790 99.9 Plus
l(1)G0232.q 3941 l(1)G0232.q 34..2801 1..2769 13790 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:47:55
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 9521909..9522812 1583..680 4520 100 Minus
chrX 22417052 chrX 9520471..9521051 2760..2179 2860 99.8 Minus
chrX 22417052 chrX 9535672..9536082 450..40 2055 100 Minus
chrX 22417052 chrX 9535371..9535603 682..450 1165 100 Minus
chrX 22417052 chrX 9521383..9521614 1974..1743 1160 100 Minus
chrX 22417052 chrX 9521109..9521320 2184..1973 1060 100 Minus
chrX 22417052 chrX 9521676..9521840 1746..1582 825 100 Minus
chrX 22417052 chrX 9550561..9550600 40..1 200 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:47:49
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0232-RC 2394 CG32697-PC 1..2394 16..2409 11970 100 Plus
l(1)G0232-RG 2373 CG32697-PG 4..2373 40..2409 11850 100 Plus
l(1)G0232-RA 2484 CG32697-PA 115..2484 40..2409 11850 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:23:33 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:47:48
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0232-RC 3053 CG32697-RC 261..3019 1..2760 13750 100 Plus
l(1)G0232-RG 5668 CG32697-RG 488..3207 40..2760 13555 100 Plus
l(1)G0232-RF 5646 CG32697-RF 466..3185 40..2760 13555 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:47:52
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0232-PC 797 CG32697-PC 1..797 16..2406 3148 100 Plus
l(1)G0232-PB 802 CG32697-PB 11..802 31..2406 3111 99.7 Plus
l(1)G0232-PG 790 CG32697-PG 2..790 40..2406 3108 100 Plus
l(1)G0232-PA 827 CG32697-PA 39..827 40..2406 3108 100 Plus
l(1)G0232-PF 597 CG32697-PF 1..597 616..2406 2470 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:47:45
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9630194..9631097 1583..680 4520 100 Minus
X 23542271 X 9628747..9629336 2769..2179 2890 99.7 Minus
X 23542271 X 9643957..9644367 450..40 2055 100 Minus
X 23542271 X 9643656..9643888 682..450 1165 100 Minus
X 23542271 X 9629668..9629899 1974..1743 1160 100 Minus
X 23542271 X 9629394..9629605 2184..1973 1060 100 Minus
X 23542271 X 9629961..9630125 1746..1582 825 100 Minus
X 23542271 X 9658846..9658885 40..1 200 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:44:16
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 9638292..9639195 1583..680 4520 100 Minus
X 23527363 X 9636845..9637434 2769..2179 2900 99.6 Minus
X 23527363 X 9652055..9652465 450..40 2055 100 Minus
X 23527363 X 9651754..9651986 682..450 1165 100 Minus
X 23527363 X 9637766..9637997 1974..1743 1160 100 Minus
X 23527363 X 9637492..9637703 2184..1973 1060 100 Minus
X 23527363 X 9638059..9638223 1746..1582 825 100 Minus
X 23527363 X 9666944..9666983 40..1 200 100 Minus
Blast to na_te.dros performed on 2014-11-27 03:47:46 has no hits.

LD30065.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 04:41:22 Download gff for LD30065.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 9550562..9550600 1..39 100   Minus
chrX 9535672..9536082 40..450 100 <- Minus
chrX 9535372..9535602 451..681 100 <- Minus
chrX 9521909..9522810 682..1583 100 <- Minus
chrX 9521678..9521838 1584..1744 100 <- Minus
chrX 9521383..9521612 1745..1974 100 <- Minus
chrX 9521111..9521318 1975..2182 100 <- Minus
chrX 9520471..9521047 2183..2760 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:21:23 Download gff for LD30065.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0232-RC 1..2394 16..2409 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:28:04 Download gff for LD30065.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0232-RC 1..2394 16..2409 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:56:36 Download gff for LD30065.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0232-RC 1..2394 16..2409 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:41:22 Download gff for LD30065.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0232-RC 1..2394 16..2409 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:21:23 Download gff for LD30065.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0232-RC 30..2788 1..2760 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:28:04 Download gff for LD30065.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0232-RC 30..2788 1..2760 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:56:36 Download gff for LD30065.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0232-RC 261..3019 1..2760 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:41:22 Download gff for LD30065.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0232-RC 261..3019 1..2760 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 04:41:22 Download gff for LD30065.complete
Subject Subject Range Query Range Percent Splice Strand
X 9658847..9658885 1..39 100   Minus
X 9643957..9644367 40..450 100 <- Minus
X 9643657..9643887 451..681 100 <- Minus
X 9630194..9631095 682..1583 100 <- Minus
X 9629963..9630123 1584..1744 100 <- Minus
X 9629668..9629897 1745..1974 100 <- Minus
X 9629396..9629603 1975..2182 100 <- Minus
X 9628756..9629332 2183..2760 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:56:36 Download gff for LD30065.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 9552880..9552918 1..39 100   Minus
arm_X 9537990..9538400 40..450 100 <- Minus
arm_X 9537690..9537920 451..681 100 <- Minus
arm_X 9524227..9525128 682..1583 100 <- Minus
arm_X 9523996..9524156 1584..1744 100 <- Minus
arm_X 9523701..9523930 1745..1974 100 <- Minus
arm_X 9523429..9523636 1975..2182 100 <- Minus
arm_X 9522789..9523365 2183..2760 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:14:06 Download gff for LD30065.complete
Subject Subject Range Query Range Percent Splice Strand
X 9666945..9666983 1..39 100   Minus
X 9652055..9652465 40..450 100 <- Minus
X 9651755..9651985 451..681 100 <- Minus
X 9638292..9639193 682..1583 100 <- Minus
X 9638061..9638221 1584..1744 100 <- Minus
X 9637766..9637995 1745..1974 100 <- Minus
X 9637494..9637701 1975..2182 100 <- Minus
X 9636854..9637430 2183..2760 99 <- Minus

LD30065.pep Sequence

Translation from 15 to 2408

> LD30065.pep
MEAEQQEFAVKQFIDLCNNLGANCSTTTATSPSTSSSSASSTQNLIAVVP
PQLQQLQVQLPAPGGGGGAGAGGGGGGGGGAAPVRRHISHTTAVKFLYAR
KFDIPRAVSLYEQHEQIRLKEYLYNIDPDVEPLRSELQTGKFTILPARTS
SGAAIALFTANRHSPLSVSHTTTLQGIVYQLDSALQDSETQRAGLVFIYD
MSGSKYSNFDYDLSQKILTLLKGGYPARLKKVLIVTAPLWFKAPFKILRL
FVREKLRERVFTVSVPQLALHVPRKALPIHLGGTLEVDHATWLLSCRQSM
TNREDELLANIVGVGGGSGSGSAAGSAAIVSTNGTETEAATTAATIISAV
HQLGDNNTTVVTVSNGVGPAGSASGGATTAASAATEPNENITINGLSPSH
RQAANNSSSSSSSAATVANPLKLNTSGSADNNSTITNATTAAGAAGAAAG
TTTNGGGEFWSENPPSSASSGFSDDDSLAGQEGDPKPIDQIVQMVKQRGR
HGLIKEYADIRNRAPEGTFLHARMRANLTKNRYTDVLCYDHSRVVLAHED
GDEPSDYINANFVDGYKQKNAYISTQGPLPKTSQDFWRMIWEQHCLVIVM
TTRVMERGRVKCGQYWEPTEESSLEFGDYHVRTISVECNEDYMVASLELR
NIKTDEIRNVSHWQFTSWPDYGVPSSAMAMLNFLQKVREKQAQLVQGLGD
TWAGHPRGPPIVVHCSAGIGRTGTFITLDICISRLEDVGTADIRGTVEKI
RSQRAYSIQMPDQYVFCHLALIEYAYSRGMLQTVDLAGFDEREPDSE*

LD30065.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:51:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22421-PA 874 GF22421-PA 41..874 9..797 3133 75.1 Plus
Dana\GF14429-PA 2028 GF14429-PA 1452..1727 485..773 541 38 Plus
Dana\GF14429-PA 2028 GF14429-PA 1759..2019 502..774 528 38.7 Plus
Dana\GF23342-PA 1249 GF23342-PA 483..751 499..773 520 38.2 Plus
Dana\GF19443-PA 1997 GF19443-PA 1308..1559 505..772 513 37.7 Plus
Dana\GF24693-PA 1455 GF24693-PA 884..1148 501..773 502 36.7 Plus
Dana\GF23342-PA 1249 GF23342-PA 775..1007 503..754 225 25.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:51:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18966-PA 833 GG18966-PA 39..833 9..797 3478 94.7 Plus
Dere\GG21203-PA 2028 GG21203-PA 1452..1727 485..773 540 38.4 Plus
Dere\GG21203-PA 2028 GG21203-PA 1759..2019 502..774 520 38 Plus
Dere\GG18436-PA 1978 GG18436-PA 1274..1525 505..772 515 37.7 Plus
Dere\GG15591-PA 1461 GG15591-PA 868..1154 484..773 501 35.7 Plus
Dere\GG18737-PA 1746 GG18737-PA 1330..1611 505..797 501 35.1 Plus
Dere\GG15591-PA 1461 GG15591-PA 1212..1450 527..775 311 31.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:51:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12435-PA 837 GH12435-PA 7..837 1..797 2988 71.8 Plus
Dgri\GH13826-PA 2039 GH13826-PA 1463..1738 485..773 548 39.4 Plus
Dgri\GH13826-PA 2039 GH13826-PA 1770..2030 502..774 524 38.3 Plus
Dgri\GH14309-PA 1250 GH14309-PA 476..744 499..773 519 37.9 Plus
Dgri\GH16835-PA 1424 GH16835-PA 827..1119 480..775 517 36.3 Plus
Dgri\GH12596-PA 1990 GH12596-PA 1290..1541 505..772 506 36.9 Plus
Dgri\GH16835-PA 1424 GH16835-PA 1172..1413 524..775 322 31.1 Plus
Dgri\GH14309-PA 1250 GH14309-PA 788..1000 522..754 211 25.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:51:28
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0232-PC 797 CG32697-PC 1..797 1..797 4120 100 Plus
l(1)G0232-PB 802 CG32697-PB 11..802 6..797 4083 99.7 Plus
l(1)G0232-PG 790 CG32697-PG 2..790 9..797 4080 100 Plus
l(1)G0232-PA 827 CG32697-PA 39..827 9..797 4080 100 Plus
l(1)G0232-PF 597 CG32697-PF 1..597 201..797 3103 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:51:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14758-PA 799 GI14758-PA 11..799 6..797 3135 76.1 Plus
Dmoj\GI20182-PA 2025 GI20182-PA 1449..1724 485..773 540 38 Plus
Dmoj\GI20182-PA 2025 GI20182-PA 1756..2016 502..774 529 38.7 Plus
Dmoj\GI13056-PA 1420 GI13056-PA 823..1115 480..775 525 36.9 Plus
Dmoj\GI10407-PA 1342 GI10407-PA 497..765 499..773 516 37.9 Plus
Dmoj\GI16226-PA 1656 GI16226-PA 1293..1544 505..772 504 36.9 Plus
Dmoj\GI13056-PA 1420 GI13056-PA 1169..1409 525..775 316 29.3 Plus
Dmoj\GI10407-PA 1342 GI10407-PA 809..1021 522..754 214 26.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:51:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16614-PA 825 GL16614-PA 4..825 2..797 2610 66.5 Plus
Dper\GL26255-PA 2029 GL26255-PA 1452..1727 485..773 549 38.7 Plus
Dper\GL26255-PA 2029 GL26255-PA 1759..2019 502..774 529 38.7 Plus
Dper\GL13888-PA 1213 GL13888-PA 464..732 499..773 518 38.2 Plus
Dper\GL13110-PA 906 GL13110-PA 195..446 505..772 508 38.1 Plus
Dper\GL15029-PA 915 GL15029-PA 488..739 505..772 499 36.6 Plus
Dper\GL13888-PA 1213 GL13888-PA 756..988 503..754 223 24.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:51:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22312-PA 850 GA22312-PA 44..850 9..797 3114 77.5 Plus
Dpse\GA28096-PA 2029 GA28096-PA 1452..1727 485..773 549 38.7 Plus
Dpse\GA28096-PA 2029 GA28096-PA 1759..2019 502..774 529 38.7 Plus
Dpse\GA30065-PC 1248 GA30065-PC 466..734 499..773 518 38 Plus
Dpse\GA30065-PD 1419 GA30065-PD 639..907 499..773 516 38.2 Plus
Dpse\GA14821-PA 1955 GA14821-PA 1247..1498 505..772 513 37.7 Plus
Dpse\GA30065-PC 1248 GA30065-PC 758..990 503..754 224 24.9 Plus
Dpse\GA30065-PD 1419 GA30065-PD 931..1163 503..754 221 24.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:51:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11354-PA 802 GM11354-PA 1..802 1..797 3558 97 Plus
Dsec\GM11394-PA 492 GM11394-PA 108..492 403..797 1494 74.7 Plus
Dsec\GM18827-PA 492 GM18827-PA 108..492 403..797 1492 74.4 Plus
Dsec\GM18820-PA 514 GM18820-PA 108..514 403..797 1406 68.3 Plus
Dsec\GM11321-PA 353 GM11321-PA 122..349 422..654 856 73 Plus
Dsec\GM11394-PA 492 GM11394-PA 2..128 223..358 445 72.1 Plus
Dsec\GM18827-PA 492 GM18827-PA 2..128 223..358 445 72.1 Plus
Dsec\GM18820-PA 514 GM18820-PA 2..128 223..358 445 72.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:51:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16047-PA 413 GD16047-PA 30..413 409..797 1562 76.1 Plus
Dsim\GD16044-PA 607 GD16044-PA 102..340 409..652 873 70.9 Plus
Dsim\GD16051-PA 218 GD16051-PA 46..210 58..222 864 98.2 Plus
Dsim\GD24230-PA 2043 GD24230-PA 1467..1742 485..773 540 38.4 Plus
Dsim\GD24230-PA 2043 GD24230-PA 1774..2034 502..774 520 38 Plus
Dsim\GD21436-PA 878 GD21436-PA 472..740 499..773 519 38 Plus
Dsim\GD16044-PA 607 GD16044-PA 2..152 223..387 419 58.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:51:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19159-PA 858 GJ19159-PA 36..858 9..797 3110 75.2 Plus
Dvir\GJ13567-PA 2025 GJ13567-PA 1449..1724 485..773 538 38.4 Plus
Dvir\GJ13567-PA 2025 GJ13567-PA 1756..2016 502..774 529 38.7 Plus
Dvir\GJ13803-PA 1422 GJ13803-PA 825..1117 480..775 523 36.6 Plus
Dvir\GJ14521-PA 1162 GJ14521-PA 379..647 499..773 517 37.9 Plus
Dvir\GJ15918-PA 1825 GJ15918-PA 1286..1537 505..772 506 36.9 Plus
Dvir\GJ13803-PA 1422 GJ13803-PA 1171..1411 525..775 317 29.7 Plus
Dvir\GJ14521-PA 1162 GJ14521-PA 691..903 522..754 214 26.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:51:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25577-PA 828 GK25577-PA 36..828 9..797 3177 78.3 Plus
Dwil\GK14922-PA 2033 GK14922-PA 1456..1732 485..773 535 37.9 Plus
Dwil\GK14922-PA 2033 GK14922-PA 1764..2024 502..774 525 38.3 Plus
Dwil\GK25195-PA 1635 GK25195-PA 1273..1524 505..772 512 37.7 Plus
Dwil\GK25460-PA 1388 GK25460-PA 856..1143 484..775 511 36.2 Plus
Dwil\GK12058-PA 1249 GK12058-PA 487..755 499..773 507 37.5 Plus
Dwil\GK25460-PA 1388 GK25460-PA 1199..1376 527..715 222 30.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:51:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15440-PA 830 GE15440-PA 39..830 9..797 3439 96.1 Plus
Dyak\GE13277-PA 2028 GE13277-PA 1452..1727 485..773 540 38.4 Plus
Dyak\GE13277-PA 2028 GE13277-PA 1759..2019 502..774 520 38 Plus
Dyak\GE23851-PA 1245 GE23851-PA 484..752 499..773 518 38.2 Plus
Dyak\GE15658-PA 1970 GE15658-PA 1274..1525 505..772 514 37.7 Plus
Dyak\GE16377-PA 1768 GE16377-PA 1332..1613 505..797 507 35.1 Plus
Dyak\GE23851-PA 1245 GE23851-PA 776..1008 503..754 221 24.9 Plus

LD30065.hyp Sequence

Translation from 15 to 2408

> LD30065.hyp
MEAEQQEFAVKQFIDLCNNLGANCSTTTATSPSTSSSSASSTQNLIAVVP
PQLQQLQVQLPAPGGGGGAGAGGGGGGGGGAAPVRRHISHTTAVKFLYAR
KFDIPRAVSLYEQHEQIRLKEYLYNIDPDVEPLRSELQTGKFTILPARTS
SGAAIALFTANRHSPLSVSHTTTLQGIVYQLDSALQDSETQRAGLVFIYD
MSGSKYSNFDYDLSQKILTLLKGGYPARLKKVLIVTAPLWFKAPFKILRL
FVREKLRERVFTVSVPQLALHVPRKALPIHLGGTLEVDHATWLLSCRQSM
TNREDELLANIVGVGGGSGSGSAAGSAAIVSTNGTETEAATTAATIISAV
HQLGDNNTTVVTVSNGVGPAGSASGGATTAASAATEPNENITINGLSPSH
RQAANNSSSSSSSAATVANPLKLNTSGSADNNSTITNATTAAGAAGAAAG
TTTNGGGEFWSENPPSSASSGFSDDDSLAGQEGDPKPIDQIVQMVKQRGR
HGLIKEYADIRNRAPEGTFLHARMRANLTKNRYTDVLCYDHSRVVLAHED
GDEPSDYINANFVDGYKQKNAYISTQGPLPKTSQDFWRMIWEQHCLVIVM
TTRVMERGRVKCGQYWEPTEESSLEFGDYHVRTISVECNEDYMVASLELR
NIKTDEIRNVSHWQFTSWPDYGVPSSAMAMLNFLQKVREKQAQLVQGLGD
TWAGHPRGPPIVVHCSAGIGRTGTFITLDICISRLEDVGTADIRGTVEKI
RSQRAYSIQMPDQYVFCHLALIEYAYSRGMLQTVDLAGFDEREPDSE*

LD30065.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:48:18
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0232-PC 797 CG32697-PC 1..797 1..797 4120 100 Plus
l(1)G0232-PB 802 CG32697-PB 11..802 6..797 4083 99.7 Plus
l(1)G0232-PG 790 CG32697-PG 2..790 9..797 4080 100 Plus
l(1)G0232-PA 827 CG32697-PA 39..827 9..797 4080 100 Plus
l(1)G0232-PF 597 CG32697-PF 1..597 201..797 3103 100 Plus