Clone LD30467 Report

Search the DGRC for LD30467

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:304
Well:67
Vector:pOT2
Associated Gene/TranscriptM1BP-RA
Protein status:LD30467.pep: gold
Preliminary Size:1659
Sequenced Size:1484

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9797 2001-01-01 Release 2 assignment
CG9797 2001-07-04 Blastp of sequenced clone
CG9797 2003-01-01 Sim4 clustering to Release 3
CG9797 2008-04-29 Release 5.5 accounting
CG9797 2008-08-15 Release 5.9 accounting
CG9797 2008-12-18 5.12 accounting

Clone Sequence Records

LD30467.complete Sequence

1484 bp (1484 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051784

> LD30467.complete
CGCGTTTATTTTTTGTGTTCACAAATATCTTAAAAACGATTTCATTTCGG
ATTGCGAATGAAAAATGTCGAAATCGGCGCTGAAACACCTAAAGAGCACC
TGCCGCGTATGCGCAAAGTATGCAAGCAACAAGCGGTCGCCGAAGTTATT
CGAGCGGAGCAACACAAAGATGATCGACAACATTGAGGCGCTCACAGGCC
TTCGGCTGGAGAACTACGGTTGCCTGCCGGATCAGATATGTGAATGCTGC
AGCATGGAACTGGCCTCCGCCGTTAAGCTGAGGGAGCGCTGCATCGCCGC
CCAGCGTGAGCTACTCTTGGGATTGACCGAGGAGCAACGCCAAGGCATCT
CGGCCTTCTACCGGGCGGCTGTCATGGGCGAGGATATTGTCCAGACGGTG
AAGACGCCCGACGATGATGAGGTCTATGCCACTTATCAGGAAATCGTATT
GGAAGAACCTAAGGAAGAGATCGACGACACCAAGGTAGAGTACGATAATA
CCTACTACGAGGTGGCCGAGGGACACGCCGGCGAGGACGACGCAGCCTCC
TTGATTGAAGAGGCCGACTATGATTCCATAATGGCCGAAGACGAAGAGCA
GCAGCAAACGTTGGAGCTGGACGAAGACACCGAGCTAATTGTGGGCGACG
TCAACGACGCGTACGTCTACGATTCGGATGATGAGGTGGCCGTTCTTGAC
AACGTGCTGGATGATGAGTACGAGCATGAAAACATTGTCGTCAAGAAGTG
TAGTCTGCCGCCAAAGCCAAAGGTCCGGTCGGATGATGCGCGTCGTCGTG
GCACCGGCGGAGTATACATCTGCGAGCAGTGCGGCAATCACATCAAGGGA
CGCATGGCCTTTGAACTTCACTGTCGTCGCCATCGTGGGGACAAGCAATT
TGGCTGCGAACTCTGTCAGTCGCGCTTCTGCACAACTTCCGAGCTGAAAC
GCCACATGCGCAAGCACACCGGAGAGCGACCGTTTGCATGTAAGTACTGT
GGCCGCTGCTTCACAGACTACACCACGCGCGTGAAGCATGAGCGTACCCA
CACCAATGAGCGCCCCTACGTCTGTGGTACTTGCGGCAAGGCCTTCACTA
CCGGCTACATCCTTAAGAACCATATGCTGATACATTCCGGCGAGCGGGCC
TACAGGTGCGAGCTGTGCGACAAGTCCTTTATGCTGCCCACCCACCTGAG
CACCCACTTCCGGTCTGGCGTACACAAGCGGCATCTGGAGAAAGCCGAGA
TGAAACAGGTCCTGGAGCAGGAGCAGAAACGTGAACTCAAGGAGGAGGAG
GAGGACAGCCTGCACATCTAAAGCTGTCCTTATAATATATACATAGCAAT
TACAGGCAATGCTAGACCGACAATGGCGCACAGCCAAGGAGCATTTCTGC
AAATAATTAACAAACCAATTGTAATATGTAGAACTTAATATTGAATAATA
AATCAAAACTTCAAATCAAAAAAAAAAAAAAAAA

LD30467.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:31:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG9797-RA 1641 CG9797-RA 146..1612 1..1467 7335 100 Plus
CG9797.a 1349 CG9797.a 49..1039 1..991 4955 100 Plus
CG9797.a 1349 CG9797.a 1038..1349 1156..1467 1560 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 13:49:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4556636..4557340 909..205 3525 100 Minus
chr3R 27901430 chr3R 4555756..4556069 1467..1154 1555 99.7 Minus
chr3R 27901430 chr3R 4556331..4556578 1157..910 1240 100 Minus
chr3R 27901430 chr3R 4557408..4557612 205..1 1025 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:49:10
Subject Length Description Subject Range Query Range Score Percent Strand
M1BP-RA 1257 CG9797-PA 1..1257 65..1321 6285 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:23:59 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:49:09
Subject Length Description Subject Range Query Range Score Percent Strand
M1BP-RA 1519 CG9797-RA 53..1519 1..1467 7335 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:49:13
Subject Length Description Subject Range Query Range Score Percent Strand
M1BP-PA 418 CG9797-PA 1..418 65..1318 2050 100 Plus
ranshi-PA 346 CG9793-PA 6..340 101..1249 744 39.6 Plus
CG11762-PA 312 CG11762-PA 2..309 89..1243 548 33 Plus
CG8159-PB 399 CG8159-PB 142..335 671..1246 527 47.4 Plus
CG31441-PA 341 CG31441-PA 1..340 80..1252 480 29 Plus
CG8159-PB 399 CG8159-PB 2..74 89..307 159 41.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:49:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8730670..8731374 909..205 3525 100 Minus
3R 32079331 3R 8729790..8730103 1467..1154 1570 100 Minus
3R 32079331 3R 8730365..8730612 1157..910 1240 100 Minus
3R 32079331 3R 8731442..8731646 205..1 1025 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:53:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8471501..8472205 909..205 3525 100 Minus
3R 31820162 3R 8470621..8470934 1467..1154 1570 100 Minus
3R 31820162 3R 8471196..8471443 1157..910 1240 100 Minus
3R 31820162 3R 8472273..8472477 205..1 1025 100 Minus
Blast to na_te.dros performed on 2014-11-27 13:49:08 has no hits.

LD30467.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 15:41:54 Download gff for LD30467.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4557408..4557612 1..205 100   Minus
chr3R 4556636..4557339 206..909 100 <- Minus
chr3R 4556333..4556578 910..1155 100 <- Minus
chr3R 4555756..4556067 1156..1467 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:11:19 Download gff for LD30467.complete
Subject Subject Range Query Range Percent Splice Strand
CG9797-RA 1..1257 65..1321 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:19:52 Download gff for LD30467.complete
Subject Subject Range Query Range Percent Splice Strand
CG9797-RA 1..1257 65..1321 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:33:55 Download gff for LD30467.complete
Subject Subject Range Query Range Percent Splice Strand
CG9797-RA 1..1257 65..1321 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:51:29 Download gff for LD30467.complete
Subject Subject Range Query Range Percent Splice Strand
CG9797-RA 1..1257 65..1321 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:41:54 Download gff for LD30467.complete
Subject Subject Range Query Range Percent Splice Strand
M1BP-RA 1..1257 65..1321 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:16:01 Download gff for LD30467.complete
Subject Subject Range Query Range Percent Splice Strand
CG9797-RA 49..1515 1..1467 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:19:52 Download gff for LD30467.complete
Subject Subject Range Query Range Percent Splice Strand
CG9797-RA 49..1515 1..1467 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:33:55 Download gff for LD30467.complete
Subject Subject Range Query Range Percent Splice Strand
CG9797-RA 53..1519 1..1467 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:51:29 Download gff for LD30467.complete
Subject Subject Range Query Range Percent Splice Strand
CG9797-RA 49..1515 1..1467 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:41:54 Download gff for LD30467.complete
Subject Subject Range Query Range Percent Splice Strand
M1BP-RA 53..1519 1..1467 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:41:54 Download gff for LD30467.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8731442..8731646 1..205 100   Minus
3R 8730670..8731373 206..909 100 <- Minus
3R 8730367..8730612 910..1155 100 <- Minus
3R 8729790..8730101 1156..1467 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:33:55 Download gff for LD30467.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4557164..4557368 1..205 100   Minus
arm_3R 4556392..4557095 206..909 100 <- Minus
arm_3R 4556089..4556334 910..1155 100 <- Minus
arm_3R 4555512..4555823 1156..1467 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:29:56 Download gff for LD30467.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8472273..8472477 1..205 100   Minus
3R 8471501..8472204 206..909 100 <- Minus
3R 8471198..8471443 910..1155 100 <- Minus
3R 8470621..8470932 1156..1467 100 <- Minus

LD30467.pep Sequence

Translation from 64 to 1320

> LD30467.pep
MSKSALKHLKSTCRVCAKYASNKRSPKLFERSNTKMIDNIEALTGLRLEN
YGCLPDQICECCSMELASAVKLRERCIAAQRELLLGLTEEQRQGISAFYR
AAVMGEDIVQTVKTPDDDEVYATYQEIVLEEPKEEIDDTKVEYDNTYYEV
AEGHAGEDDAASLIEEADYDSIMAEDEEQQQTLELDEDTELIVGDVNDAY
VYDSDDEVAVLDNVLDDEYEHENIVVKKCSLPPKPKVRSDDARRRGTGGV
YICEQCGNHIKGRMAFELHCRRHRGDKQFGCELCQSRFCTTSELKRHMRK
HTGERPFACKYCGRCFTDYTTRVKHERTHTNERPYVCGTCGKAFTTGYIL
KNHMLIHSGERAYRCELCDKSFMLPTHLSTHFRSGVHKRHLEKAEMKQVL
EQEQKRELKEEEEDSLHI*

LD30467.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 05:51:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16841-PA 430 GF16841-PA 1..430 1..418 1887 81.4 Plus
Dana\GF18186-PA 409 GF18186-PA 151..346 202..396 510 45.4 Plus
Dana\GF18185-PA 317 GF18185-PA 2..315 9..392 490 31 Plus
Dana\GF18383-PA 412 GF18383-PA 5..404 13..394 447 31.5 Plus
Dana\GF22975-PA 367 GF22975-PA 1..338 9..390 422 30.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 05:51:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17429-PA 418 GG17429-PA 1..418 1..418 2181 96.9 Plus
Dere\GG17430-PA 347 GG17430-PA 5..333 12..389 723 42.3 Plus
Dere\GG12737-PA 394 GG12737-PA 181..355 240..412 521 51.4 Plus
Dere\GG18288-PA 425 GG18288-PA 5..423 13..402 483 29.9 Plus
Dere\GG12626-PA 304 GG12626-PA 81..297 170..392 468 40.1 Plus
Dere\GG12737-PA 394 GG12737-PA 2..74 9..81 162 41.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 05:51:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19016-PA 442 GH19016-PA 1..440 1..418 1335 58.4 Plus
Dgri\GH19018-PA 716 GH19018-PA 349..708 14..393 824 45.5 Plus
Dgri\GH19018-PA 716 GH19018-PA 2..349 13..364 813 48.6 Plus
Dgri\GH18577-PA 386 GH18577-PA 2..348 9..402 553 34.3 Plus
Dgri\GH18576-PA 371 GH18576-PA 2..364 13..398 542 33.9 Plus
Dgri\GH18112-PA 426 GH18112-PA 5..417 13..387 466 32.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 05:51:26
Subject Length Description Subject Range Query Range Score Percent Strand
M1BP-PA 418 CG9797-PA 1..418 1..418 2234 100 Plus
ranshi-PA 346 CG9793-PA 6..340 13..395 758 39.8 Plus
CG8159-PB 399 CG8159-PB 2..335 9..394 636 34.7 Plus
CG11762-PA 312 CG11762-PA 2..309 9..393 561 33.2 Plus
CG18764-PA 409 CG18764-PA 5..395 13..387 504 31.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 05:51:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10369-PA 436 GI10369-PA 1..434 1..418 1384 61.2 Plus
Dmoj\GI10370-PA 703 GI10370-PA 2..384 9..392 952 48.8 Plus
Dmoj\GI10370-PA 703 GI10370-PA 469..700 170..400 625 52.3 Plus
Dmoj\GI22393-PA 359 GI22393-PA 6..358 13..404 597 33.3 Plus
Dmoj\GI22394-PA 371 GI22394-PA 2..340 9..398 571 33.6 Plus
Dmoj\GI24613-PA 425 GI24613-PA 5..408 13..387 432 31.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 05:51:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12135-PA 433 GL12135-PA 1..433 1..418 1655 73.3 Plus
Dper\GL12478-PA 401 GL12478-PA 2..356 9..415 561 33.8 Plus
Dper\GL12476-PA 333 GL12476-PA 2..333 9..400 548 33.8 Plus
Dper\GL22112-PA 374 GL22112-PA 23..368 28..400 447 30.9 Plus
Dper\GL22114-PA 400 GL22114-PA 5..399 13..396 415 28.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 05:51:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22043-PA 398 GA22043-PA 1..398 36..418 1501 73.2 Plus
Dpse\GA20857-PA 401 GA20857-PA 2..356 9..415 559 33.7 Plus
Dpse\GA11182-PA 333 GA11182-PA 184..333 251..400 486 55.3 Plus
Dpse\GA13193-PA 374 GA13193-PA 7..368 13..400 455 30.5 Plus
Dpse\GA27381-PB 385 GA27381-PB 5..374 13..401 421 30.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 05:51:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26321-PA 154 GM26321-PA 5..154 269..418 797 98.7 Plus
Dsec\GM26322-PA 346 GM26322-PA 2..335 13..395 715 41.4 Plus
Dsec\GM26320-PA 111 GM26320-PA 1..111 1..111 569 97.3 Plus
Dsec\GM23758-PA 312 GM23758-PA 2..309 9..393 525 32.2 Plus
Dsec\GM23759-PA 399 GM23759-PA 162..336 233..395 523 52.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 05:51:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20849-PA 397 GD20849-PA 1..387 1..396 852 43.9 Plus
Dsim\GD18569-PA 312 GD18569-PA 2..309 9..393 528 32.2 Plus
Dsim\GD18570-PA 399 GD18570-PA 165..336 237..395 519 52.9 Plus
Dsim\GD18769-PA 413 GD18769-PA 5..399 13..387 480 31.4 Plus
Dsim\GD20673-PA 394 GD20673-PA 4..338 9..396 437 28.3 Plus
Dsim\GD18570-PA 399 GD18570-PA 2..74 9..81 164 42.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 05:51:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24585-PA 436 GJ24585-PA 1..434 1..418 1386 62 Plus
Dvir\GJ24586-PA 743 GJ24586-PA 2..395 9..401 946 47.5 Plus
Dvir\GJ24586-PA 743 GJ24586-PA 391..734 45..393 781 46.5 Plus
Dvir\GJ22678-PA 361 GJ22678-PA 2..355 9..399 652 36.7 Plus
Dvir\GJ22679-PA 375 GJ22679-PA 2..346 9..398 527 33.5 Plus
Dvir\GJ22564-PA 424 GJ22564-PA 5..410 13..387 456 32 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 05:51:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11271-PA 440 GK11271-PA 1..433 1..414 1499 66.2 Plus
Dwil\GK11270-PA 359 GK11270-PA 4..354 13..397 791 43.9 Plus
Dwil\GK11276-PA 396 GK11276-PA 2..369 9..397 602 35 Plus
Dwil\GK11273-PA 347 GK11273-PA 2..340 9..397 538 33.4 Plus
Dwil\GK11090-PA 394 GK11090-PA 5..390 13..402 429 29.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 05:51:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24830-PA 418 GE24830-PA 1..418 1..418 2185 97.1 Plus
Dyak\GE24832-PA 344 GE24832-PA 5..338 12..394 732 40.8 Plus
Dyak\GE25903-PA 398 GE25903-PA 161..336 233..395 525 52.3 Plus
Dyak\GE24186-PA 431 GE24186-PA 5..417 13..387 468 30.9 Plus
Dyak\GE25902-PA 306 GE25902-PA 155..292 250..387 447 54.3 Plus
Dyak\GE25903-PA 398 GE25903-PA 2..74 9..81 152 38.4 Plus

LD30467.hyp Sequence

Translation from 64 to 1320

> LD30467.hyp
MSKSALKHLKSTCRVCAKYASNKRSPKLFERSNTKMIDNIEALTGLRLEN
YGCLPDQICECCSMELASAVKLRERCIAAQRELLLGLTEEQRQGISAFYR
AAVMGEDIVQTVKTPDDDEVYATYQEIVLEEPKEEIDDTKVEYDNTYYEV
AEGHAGEDDAASLIEEADYDSIMAEDEEQQQTLELDEDTELIVGDVNDAY
VYDSDDEVAVLDNVLDDEYEHENIVVKKCSLPPKPKVRSDDARRRGTGGV
YICEQCGNHIKGRMAFELHCRRHRGDKQFGCELCQSRFCTTSELKRHMRK
HTGERPFACKYCGRCFTDYTTRVKHERTHTNERPYVCGTCGKAFTTGYIL
KNHMLIHSGERAYRCELCDKSFMLPTHLSTHFRSGVHKRHLEKAEMKQVL
EQEQKRELKEEEEDSLHI*

LD30467.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:03:57
Subject Length Description Subject Range Query Range Score Percent Strand
M1BP-PA 418 CG9797-PA 1..418 1..418 2234 100 Plus
ranshi-PA 346 CG9793-PA 6..340 13..395 758 39.8 Plus
CG8159-PB 399 CG8159-PB 2..335 9..394 636 34.7 Plus
CG11762-PA 312 CG11762-PA 2..309 9..393 561 33.2 Plus
CG18764-PA 409 CG18764-PA 5..395 13..387 504 31.5 Plus