Clone LD31233 Report

Search the DGRC for LD31233

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:312
Well:33
Vector:pOT2
Associated Gene/Transcriptgish-RE
Protein status:LD31233.pep: gold
Sequenced Size:1991

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
gish-RA 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

LD31233.complete Sequence

1991 bp assembled on 2011-01-03

GenBank Submission: BT125862.1

> LD31233.complete
AAACAAAAGCAGCAGCGGCAGTCGATAAAAAAATCATTATCAAAATTACG
GAAAAGCGATCAAAATTCAAGCGAGATTAGCTAGGCGAAATGCAGCGACG
AGAACGGCAAGCAAGTGGCGGTGGCCCACAAACGACAACTGCCGGTCCAT
CCGCTGGTAATGTGGCAAATGCCACCACAGCCCTAGCCGGTGGTAAAAGC
TCAAGCAATAACATGTATTCCACCCGCCAATCTGTAAGCACCACGACCGG
TGTACTTATGGTCGGACCAAATTTTCGTGTCGGTAAAAAAATTGGCTGTG
GTAATTTTGGCGAATTGCGTTTAGGCAAAAACCTTTACAACAATGAACAT
GTAGCAATAAAAATGGAGCCTATGAAGTCAAAGGCTCCGCAACTACACTT
AGAGTATAGGTTTTATAAACTATTAGGATCACATGCAGAGGGTGTACCAG
AAGTATATTACTTCGGCCCATGCGGCAAATACAATGCTCTTGTTATGGAG
TTGCTTGGTCCATCACTTGAAGATTTATTCGATATTTGCGGCAGACGTTT
CACTTTGAAGAGCGTACTTCTGATAGCTATACAATTACTCCACCGGATCG
AATATGTTCATAGTCGGCACTTAATATATAGGGATGTGAAACCAGAGAAC
TTTCTCATTGGCAGAACGTCAACAAAACGTGAAAAAATTATACATATAAT
TGATTTCGGTTTGGCCAAAGAATACATTGATTTAGATACAAATAGGCATA
TACCATATCGGGAGCATAAATCCCTAACTGGAACGGCACGTTATATGTCA
ATCAACACGCACATGGGGCGTGAGCAGTCGCGACGCGATGATCTGGAGGC
ATTGGGGCATATGTTTATGTATTTCTTAAGGGGTTCACTGCCGTGGCAAG
GCCTAAAGGCTGATACACTCAAGGAGAGATATCAAAAAATCGGTGATACG
AAACGAGCAACGCCCATCGAGGTGCTTTGTGATGGACATCCGGAAGAGTT
TGCGACATATTTGCGTTATGTACGGCGGTTAGATTTTTTCGAAACTCCCG
ACTATGATTTTCTGCGAAGACTGTTTCAAGACTTATTCGATCGTAAGGGA
TACACCGACGAGGGCGAGTTCGACTGGACAGGGAAGACAATGTCAACGCC
CGTCGGATCTCTGCAAACTGGCCATGAAGTCATCATTTCACCAAATAAAG
ATCGTCATAATGTTACGGCTAAGACAAATGCCAAAGGAGGTGTTGCTGCG
TGGCCTGATGTGCCAAAGCCGGGGGCAACACTGGGCAATCTAACGCCGGC
CGATCGGCATGGTTCAGTACAGGTTGTGAGTTCGACGAATGGCGAACTAA
ATCCGGACGATCCCACGGCCGGACACTCAAACACGCCCATCACACAGCAG
CCGGAAGTCGAAGTGGTCGATGAAACAAAATGTTGTTGTTTCTTTAAACG
AAAGAAGAAGAAATCGACGCGCCAAAAATGACTAGACGGTGTACAATGTA
GTCCAGAACGCGAGGCAGTCACCCTGCTGCGTGCCACTTCACATTCAAAC
TCACGGGATAGCGTATTGAATAATCCGAGTCAGGATTATATCCAGCAGGC
AACGTCGCAGCATACGTTGCGTTATCCTCCATCCGCGTCGATGTTGACGC
CAACACCAACTACAAACACACCGACACTTCCGTTGTAATTTATATAAATA
TAAAGCCAGATGCAAAATGCAGAAAGCAACAAAAAAAATATTAAACGAAA
CCCAACAAAACAAAAACAAAACAAATGAACCCCGTACACATTAAATACAC
TAAAAAACAGTAAAAACAAACAAAATGAAACCAATTTTGATTAATTATTG
TAATGATTGTATTTTATTATTATTTTTATTATTTACCAATTTTGCGTTTA
TTATATAAATTATTATAATTATTAATTATATTATTAATTAATGCTATTAT
AAATAAAAAAGAAAAGAAAATTCAAAAAAAAAAAAAAAAAA

LD31233.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:41:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 12126496..12127028 1430..1973 2490 97.6 Plus
chr3R 27901430 chr3R 12121508..12121780 702..974 1365 100 Plus
chr3R 27901430 chr3R 12114285..12114496 114..325 1060 100 Plus
chr3R 27901430 chr3R 12121846..12122018 970..1142 865 100 Plus
chr3R 27901430 chr3R 12120341..12120493 435..587 765 100 Plus
chr3R 27901430 chr3R 12099711..12099825 1..115 575 100 Plus
chr3R 27901430 chr3R 12121335..12121449 588..702 575 100 Plus
chr3R 27901430 chr3R 12117395..12117507 323..435 565 100 Plus
chr3R 27901430 chr3R 12125915..12126024 1320..1429 550 100 Plus
chr3R 27901430 chr3R 12124262..12124364 1222..1324 515 100 Plus
chr3R 27901430 chr3R 12123142..12123223 1142..1223 410 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:41:37
Subject Length Description Subject Range Query Range Score Percent Strand
gish-RE 1392 CG6963-PE 1..1392 90..1481 6960 100 Plus
gish-RA 1269 CG6963-PA 1..1269 213..1481 6345 100 Plus
gish-RL 1614 CG6963-PL 497..1614 571..1688 5530 99.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:41:36
Subject Length Description Subject Range Query Range Score Percent Strand
gish-RE 3212 CG6963-RE 1234..3206 1..1973 9865 100 Plus
gish-RA 2677 CG6963-RA 464..2322 115..1973 9295 100 Plus
gish-RM 5623 CG6963-RM 1819..3221 571..1973 6955 99.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:41:40
Subject Length Description Subject Range Query Range Score Percent Strand
gish-PL 537 CG6963-PL 1..523 90..1643 2544 95.4 Plus
gish-PE 463 CG6963-PE 1..463 90..1478 2375 100 Plus
gish-PM 468 CG6963-PM 1..468 90..1478 2271 95.1 Plus
gish-PH 468 CG6963-PH 1..468 90..1478 2271 95.1 Plus
gish-PD 468 CG6963-PD 1..468 90..1478 2271 95.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:41:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 16301823..16302369 1430..1976 2735 100 Plus
3R 32079331 3R 16296835..16297107 702..974 1365 100 Plus
3R 32079331 3R 16289629..16289840 114..325 1060 100 Plus
3R 32079331 3R 16297173..16297345 970..1142 865 100 Plus
3R 32079331 3R 16295668..16295820 435..587 765 100 Plus
3R 32079331 3R 16275055..16275169 1..115 575 100 Plus
3R 32079331 3R 16296662..16296776 588..702 575 100 Plus
3R 32079331 3R 16292722..16292834 323..435 565 100 Plus
3R 32079331 3R 16301242..16301351 1320..1429 550 100 Plus
3R 32079331 3R 16299589..16299691 1222..1324 515 100 Plus
3R 32079331 3R 16298469..16298550 1142..1223 410 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:04:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 16042654..16043200 1430..1976 2735 100 Plus
3R 31820162 3R 16037666..16037938 702..974 1365 100 Plus
3R 31820162 3R 16030460..16030671 114..325 1060 100 Plus
3R 31820162 3R 16038004..16038176 970..1142 865 100 Plus
3R 31820162 3R 16036499..16036651 435..587 765 100 Plus
3R 31820162 3R 16037493..16037607 588..702 575 100 Plus
3R 31820162 3R 16015886..16016000 1..115 575 100 Plus
3R 31820162 3R 16033553..16033665 323..435 565 100 Plus
3R 31820162 3R 16042073..16042182 1320..1429 550 100 Plus
3R 31820162 3R 16040420..16040522 1222..1324 515 100 Plus
3R 31820162 3R 16039300..16039381 1142..1223 410 100 Plus
Blast to na_te.dros performed on 2014-11-27 16:41:35 has no hits.

LD31233.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:56:24 Download gff for LD31233.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 12126496..12126791 1430..1725 99 -> Plus
chr3R 12125918..12126024 1323..1429 100 -> Plus
chr3R 12124264..12124362 1224..1322 100 -> Plus
chr3R 12123143..12123223 1143..1223 100 -> Plus
chr3R 12121848..12122018 972..1142 100 -> Plus
chr3R 12121509..12121777 703..971 100 -> Plus
chr3R 12121335..12121449 588..702 100 -> Plus
chr3R 12120342..12120493 436..587 100 -> Plus
chr3R 12117397..12117507 325..435 100 -> Plus
chr3R 12114287..12114495 116..324 100 -> Plus
chr3R 12099711..12099825 1..115 100 -> Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-01-05 09:00:59 Download gff for LD31233.complete
Subject Subject Range Query Range Percent Splice Strand
gish-RE 1..1392 90..1481 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:37:13 Download gff for LD31233.complete
Subject Subject Range Query Range Percent Splice Strand
gish-RE 1..1392 90..1481 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:56:24 Download gff for LD31233.complete
Subject Subject Range Query Range Percent Splice Strand
gish-RE 1..1392 90..1481 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-05 09:00:59 Download gff for LD31233.complete
Subject Subject Range Query Range Percent Splice Strand
gish-RE 1228..3175 1..1948 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:37:13 Download gff for LD31233.complete
Subject Subject Range Query Range Percent Splice Strand
gish-RE 1234..3181 1..1948 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:56:24 Download gff for LD31233.complete
Subject Subject Range Query Range Percent Splice Strand
gish-RE 1234..3181 1..1948 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:56:24 Download gff for LD31233.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16301823..16302341 1430..1948 100   Plus
3R 16301245..16301351 1323..1429 100 -> Plus
3R 16299591..16299689 1224..1322 100 -> Plus
3R 16298470..16298550 1143..1223 100 -> Plus
3R 16297175..16297345 972..1142 100 -> Plus
3R 16296836..16297104 703..971 100 -> Plus
3R 16296662..16296776 588..702 100 -> Plus
3R 16295669..16295820 436..587 100 -> Plus
3R 16292724..16292834 325..435 100 -> Plus
3R 16289631..16289839 116..324 100 -> Plus
3R 16275055..16275169 1..115 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:37:13 Download gff for LD31233.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12127545..12128063 1430..1948 100   Plus
arm_3R 12126967..12127073 1323..1429 100 -> Plus
arm_3R 12125313..12125411 1224..1322 100 -> Plus
arm_3R 12124192..12124272 1143..1223 100 -> Plus
arm_3R 12122897..12123067 972..1142 100 -> Plus
arm_3R 12122558..12122826 703..971 100 -> Plus
arm_3R 12122384..12122498 588..702 100 -> Plus
arm_3R 12121391..12121542 436..587 100 -> Plus
arm_3R 12118446..12118556 325..435 100 -> Plus
arm_3R 12115353..12115561 116..324 100 -> Plus
arm_3R 12100777..12100891 1..115 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:53:29 Download gff for LD31233.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16042654..16043172 1430..1948 100   Plus
3R 16042076..16042182 1323..1429 100 -> Plus
3R 16040422..16040520 1224..1322 100 -> Plus
3R 16039301..16039381 1143..1223 100 -> Plus
3R 16038006..16038176 972..1142 100 -> Plus
3R 16037667..16037935 703..971 100 -> Plus
3R 16037493..16037607 588..702 100 -> Plus
3R 16036500..16036651 436..587 100 -> Plus
3R 16033555..16033665 325..435 100 -> Plus
3R 16030462..16030670 116..324 100 -> Plus
3R 16015886..16016000 1..115 100 -> Plus

LD31233.pep Sequence

Translation from 89 to 1480

> LD31233.pep
MQRRERQASGGGPQTTTAGPSAGNVANATTALAGGKSSSNNMYSTRQSVS
TTTGVLMVGPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAP
QLHLEYRFYKLLGSHAEGVPEVYYFGPCGKYNALVMELLGPSLEDLFDIC
GRRFTLKSVLLIAIQLLHRIEYVHSRHLIYRDVKPENFLIGRTSTKREKI
IHIIDFGLAKEYIDLDTNRHIPYREHKSLTGTARYMSINTHMGREQSRRD
DLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCDGH
PEEFATYLRYVRRLDFFETPDYDFLRRLFQDLFDRKGYTDEGEFDWTGKT
MSTPVGSLQTGHEVIISPNKDRHNVTAKTNAKGGVAAWPDVPKPGATLGN
LTPADRHGSVQVVSSTNGELNPDDPTAGHSNTPITQQPEVEVVDETKCCC
FFKRKKKKSTRQK*

LD31233.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 12:09:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18486-PA 474 GF18486-PA 13..474 6..463 2242 93.3 Plus
Dana\GF23293-PA 441 GF23293-PA 3..291 56..347 856 53.8 Plus
Dana\GF21383-PA 337 GF21383-PA 14..312 56..357 774 50.3 Plus
Dana\GF19391-PA 344 GF19391-PA 16..284 61..332 745 51.8 Plus
Dana\GF13879-PA 415 GF13879-PA 15..307 57..352 740 48 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 12:09:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16991-PA 468 GG16991-PA 1..468 1..463 2318 94.9 Plus
Dere\GG11892-PA 440 GG11892-PA 3..291 56..347 855 53.8 Plus
Dere\GG17734-PA 337 GG17734-PA 14..312 56..357 773 50.3 Plus
Dere\GG17715-PA 344 GG17715-PA 16..303 61..351 752 49.1 Plus
Dere\GG21733-PA 394 GG21733-PA 22..330 57..378 711 44.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 12:09:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19542-PA 459 GH19542-PA 1..459 1..463 2357 97.6 Plus
Dgri\GH14346-PA 439 GH14346-PA 3..291 56..347 859 53.8 Plus
Dgri\GH12114-PA 343 GH12114-PA 14..315 56..360 804 51.1 Plus
Dgri\GH12595-PA 343 GH12595-PA 5..338 47..382 780 46.6 Plus
Dgri\GH17562-PA 345 GH17562-PA 9..298 59..346 728 49.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:09:45
Subject Length Description Subject Range Query Range Score Percent Strand
gish-PE 463 CG6963-PE 1..463 1..463 2461 100 Plus
gish-PM 468 CG6963-PM 1..468 1..463 2357 95.1 Plus
gish-PL 537 CG6963-PL 1..468 1..463 2357 95.1 Plus
gish-PH 468 CG6963-PH 1..468 1..463 2357 95.1 Plus
gish-PD 468 CG6963-PD 1..468 1..463 2357 95.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 12:09:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22941-PA 461 GI22941-PA 1..461 1..463 2381 98.5 Plus
Dmoj\GI16325-PA 343 GI16325-PA 14..337 56..382 800 47.4 Plus
Dmoj\GI16225-PA 343 GI16225-PA 14..338 56..382 766 47.3 Plus
Dmoj\GI22355-PA 379 GI22355-PA 22..309 57..347 723 49.5 Plus
Dmoj\GI22988-PA 328 GI22988-PA 17..296 61..346 712 49.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 12:09:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21596-PA 468 GL21596-PA 1..468 1..463 2293 94.2 Plus
Dper\GL13140-PA 288 GL13140-PA 14..287 56..332 752 52.7 Plus
Dper\GL25396-PA 345 GL25396-PA 2..302 47..351 727 46.9 Plus
Dper\GL15889-PA 374 GL15889-PA 29..316 57..347 711 47.1 Plus
Dper\GL22167-PA 475 GL22167-PA 133..420 56..347 695 45.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 12:09:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19988-PB 468 GA19988-PB 1..468 1..463 2293 94.2 Plus
Dpse\GA19988-PC 422 GA19988-PC 1..422 42..463 2285 99.8 Plus
Dpse\GA19988-PD 355 GA19988-PD 3..355 6..353 1728 91.2 Plus
Dpse\GA15205-PD 439 GA15205-PD 3..405 56..439 864 45.1 Plus
Dpse\GA15205-PB 439 GA15205-PB 3..405 56..439 864 45.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 12:09:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15143-PA 476 GM15143-PA 14..476 6..463 2275 94.2 Plus
Dsec\GM12110-PA 440 GM12110-PA 3..291 56..347 855 53.8 Plus
Dsec\GM11579-PA 337 GM11579-PA 14..312 56..357 775 50.3 Plus
Dsec\GM11559-PA 344 GM11559-PA 16..303 61..351 749 49.1 Plus
Dsec\GM17114-PA 379 GM17114-PA 21..309 56..347 700 46.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 12:09:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19086-PA 476 GD19086-PA 14..476 6..463 2275 94.2 Plus
Dsim\GD16644-PA 395 GD16644-PA 3..291 56..347 854 53.8 Plus
Dsim\GD17076-PA 344 GD17076-PA 16..303 61..351 749 49.1 Plus
Dsim\GD22814-PA 319 GD22814-PA 17..296 64..346 636 44.9 Plus
Dsim\GD24797-PA 157 GD24797-PA 14..152 56..195 342 46.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 12:09:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23721-PA 461 GJ23721-PA 1..461 1..463 2383 98.7 Plus
Dvir\GJ10658-PA 443 GJ10658-PA 3..291 56..347 855 53.4 Plus
Dvir\GJ15665-PA 343 GJ15665-PA 14..302 56..347 805 52.4 Plus
Dvir\GJ15916-PA 343 GJ15916-PA 14..338 56..382 773 47.6 Plus
Dvir\GJ16877-PA 344 GJ16877-PA 16..335 61..391 730 44.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 12:09:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13771-PA 468 GK13771-PA 1..468 1..463 2274 93.8 Plus
Dwil\GK22559-PA 425 GK22559-PA 3..291 56..347 859 53.8 Plus
Dwil\GK25517-PA 337 GK25517-PA 14..312 56..357 775 50.3 Plus
Dwil\GK24490-PA 325 GK24490-PA 12..315 56..362 771 48.4 Plus
Dwil\GK18163-PA 397 GK18163-PA 4..309 38..347 732 46.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 12:10:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24384-PA 494 GE24384-PA 1..494 1..463 2286 89.9 Plus
Dyak\GE23340-PA 440 GE23340-PA 3..291 56..347 855 53.8 Plus
Dyak\GE17024-PA 337 GE17024-PA 14..312 56..357 775 50.3 Plus
Dyak\GE13122-PA 390 GE13122-PA 22..315 57..353 702 45.8 Plus
Dyak\GE25283-PA 480 GE25283-PA 52..354 42..346 679 43 Plus

LD31233.hyp Sequence

Translation from 89 to 1480

> LD31233.hyp
MQRRERQASGGGPQTTTAGPSAGNVANATTALAGGKSSSNNMYSTRQSVS
TTTGVLMVGPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAP
QLHLEYRFYKLLGSHAEGVPEVYYFGPCGKYNALVMELLGPSLEDLFDIC
GRRFTLKSVLLIAIQLLHRIEYVHSRHLIYRDVKPENFLIGRTSTKREKI
IHIIDFGLAKEYIDLDTNRHIPYREHKSLTGTARYMSINTHMGREQSRRD
DLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCDGH
PEEFATYLRYVRRLDFFETPDYDFLRRLFQDLFDRKGYTDEGEFDWTGKT
MSTPVGSLQTGHEVIISPNKDRHNVTAKTNAKGGVAAWPDVPKPGATLGN
LTPADRHGSVQVVSSTNGELNPDDPTAGHSNTPITQQPEVEVVDETKCCC
FFKRKKKKSTRQK*

LD31233.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:51:45
Subject Length Description Subject Range Query Range Score Percent Strand
gish-PE 463 CG6963-PE 1..463 1..463 2461 100 Plus
gish-PM 468 CG6963-PM 1..468 1..463 2357 95.1 Plus
gish-PL 537 CG6963-PL 1..468 1..463 2357 95.1 Plus
gish-PH 468 CG6963-PH 1..468 1..463 2357 95.1 Plus
gish-PD 468 CG6963-PD 1..468 1..463 2357 95.1 Plus