Clone LD31377 Report

Search the DGRC for LD31377

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:313
Well:77
Vector:pOT2
Associated Gene/TranscriptAP-1mu-RA
Protein status:LD31377.pep: gold
Preliminary Size:1787
Sequenced Size:1755

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9388 2001-01-01 Release 2 assignment
CG9388 2001-09-19 Blastp of sequenced clone
CG9388 2003-01-01 Sim4 clustering to Release 3
AP-47 2008-04-29 Release 5.5 accounting
AP-47 2008-08-15 Release 5.9 accounting
AP-47 2008-12-18 5.12 accounting

Clone Sequence Records

LD31377.complete Sequence

1755 bp (1755 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058621

> LD31377.complete
CTAATAAGAAAAAGAAGCAGCAGAAAAGGCGACGTAAGAAATTCCGGAGT
TTTCATTCGCATTTTCCAGTCTACGAAACGGAATATGTAAATCCAGCCCA
TTGATAGACCTAGCCCACTCATCGCCACCTCGCGACAGTTGCCAACTTCC
ACGCGCAACGCCTGCCGCGAGCAGTAGAACCATCGAAGCGACCTCCCACT
CGATCCAATTGGGAATTTTACACCTGGGACAAGTGGCAGCTGCTGGGAAC
CAAGAGACATGTCTTCGTCGGCCATTTTCGTTCTGGACGTGAAGGGCAAG
GTGCTGATATCGCGGAACTACCGCGGTGACAACATCGACATGGCCGTGAT
CGACAAATTCATGCCATTGCTGATGGAGCGCGAGGAGGAGGGCCTAATCA
CTCCGATCCTTCAGACGGCGGAGACTACATTTGCCTACATCAAAACGAAC
AATCTTTATATCGTATCCACGACGCCGCGCAATAAGAACGTTAATATCGC
TCTGGTCTTCGTCTTTCTGCACAAGATCGCGCAGGTCTTTGTGGAATACT
TCAAGGAGCTGGAGGAGGAGTCCATTCGGGACAATTTCGTGATCATCTAC
GAGCTGCTGGATGAATTGCTCGACTTTGGCTACCCGCAGACCACCGACTC
GAAAATTCTACAGGAATACATTACGCAGGAGGGTCATAAGCTGGAGCTAC
AGCCCCGCATCCCGGTGGCCGTGACCAATGCAGTATCCTGGCGGTCCGAG
GGCATTAAGTATCGCAAGAACGAGGTGTTCCTGGACGTTATCGAGTCGGT
GAATCTTCTCGCAAACGCCAATGGCAATGTGCTGCGCAGCGAGATCGTGG
GCGCCATTAAGATGCGCGTCTACTTGTCGGGAATGCCAGAGCTGCGACTG
GGTCTCAACGACAAGGTTCTGTTCGAGAGCACGGGCCGCGGCAAGTCAAA
GTCCGTAGAGCTGGAGGACGTCAAGTTCCACCAGTGCGTGCGGTTGTCAC
GCTTCGAGAATGACCGGACAATCTCGTTCATTCCTCCGGACGGCGAGTTC
GAACTGATGTCCTATCGTCTGAACACGCATGTCAAACCCCTGATTTGGAT
CGAATCAGTGATCGAGCGGCATGCCCACTCCCGTGTGGAGTACATGATTA
AGGCGAAGTCTCAGTTCAAGCGAAGATCGACGGCCAACAACGTGGAAATC
GTCATACCAGTGCCCGCCGACGCGGACTCACCCAAGTTCAAGACCACCAT
TGGAAGCTGCAAGTACGCACCGGAGCAGAACGCAATCATCTGGACGATCA
AATCGTTCCCGGGTGGCAAGGAGTATCTAATGCGGGCACATTTCGGTCTG
CCGAGCGTGGAAAGCGAGGACAATACGGAGGGCAAGCCGCCAATTCAGGT
GCGCTTCGAGATTCCCTACTTTACCACGTCGGGCATCCAGGTGCGCTATC
TGAAGATCATCGAGAAGAGCGGCTATCAGGCGCTGCCATGGGTGCGGTAC
ATCACGCAGAACGGCGACTATCAGCTACGCACCAATTGAAAGGGGCAACT
CCCGTTCCTGCATCATTCCAGCCAAGCTTCAGCGAGTCATCCTGCAACAG
GTAGCTTCATCTCCACCCGCGTTTTTGTCTGCGATGCGTTGCGTTAAGTC
AAAAGTATATATTTGTATTCGTATTGTTTCAGTATATGTATATTGTATGT
AAATCAAATTTAATAAATTTTAACACCTTTTCATAACAAAAAAAAAAAAA
AAAAA

LD31377.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:18:37
Subject Length Description Subject Range Query Range Score Percent Strand
AP-47-RA 1898 AP-47-RA 131..1868 1..1738 8690 100 Plus
AP-47.a 1692 AP-47.a 52..1692 97..1737 8205 100 Plus
AP-47.b 1835 AP-47.b 195..1835 97..1737 8205 100 Plus
AP-47.a 1692 AP-47.a 19..51 1..33 165 100 Plus
AP-47.b 1835 AP-47.b 162..194 1..33 165 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 10:51:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5384258..5385339 1082..1 5380 99.8 Minus
chr3R 27901430 chr3R 5383544..5384200 1737..1081 3285 100 Minus
chr3R 27901430 chr3R 18286525..18286589 586..650 235 90.8 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:51:44
Subject Length Description Subject Range Query Range Score Percent Strand
AP-1mu-RA 1281 CG9388-PA 1..1281 259..1539 6405 100 Plus
AP-2mu-RC 1314 CG7057-PC 313..377 586..650 235 90.8 Plus
AP-2mu-RB 1314 CG7057-PB 313..377 586..650 235 90.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:25:09 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:51:43
Subject Length Description Subject Range Query Range Score Percent Strand
AP-1mu-RA 1755 CG9388-RA 19..1755 1..1737 8685 100 Plus
CG8199-RA 1750 CG8199-RA 1686..1750 1737..1673 325 100 Minus
AP-2mu-RC 1976 CG7057-RC 461..525 586..650 235 90.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 10:51:46
Subject Length Description Subject Range Query Range Score Percent Strand
AP-1mu-PA 426 CG9388-PA 1..426 259..1536 2114 100 Plus
AP-2mu-PC 437 CG7057-PC 5..436 274..1530 809 42.2 Plus
AP-2mu-PB 437 CG7057-PB 5..436 274..1530 809 42.2 Plus
AP-2mu-PA 437 CG7057-PA 5..436 274..1530 809 42.2 Plus
cm-PB 415 CG3035-PB 4..414 271..1530 424 27.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:51:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9558426..9559507 1082..1 5410 100 Minus
3R 32079331 3R 9557711..9558368 1738..1081 3290 100 Minus
3R 32079331 3R 22462983..22463047 586..650 235 90.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:41:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9299257..9300338 1082..1 5410 100 Minus
3R 31820162 3R 9298542..9299199 1738..1081 3290 100 Minus
3R 31820162 3R 22203814..22203878 586..650 235 90.7 Plus
Blast to na_te.dros performed on 2014-11-27 10:51:42 has no hits.

LD31377.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 12:36:15 Download gff for LD31377.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5384260..5385339 1..1080 99   Minus
chr3R 5383544..5384200 1081..1737 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:12:39 Download gff for LD31377.complete
Subject Subject Range Query Range Percent Splice Strand
AP-47-RA 1..1281 259..1539 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:01:20 Download gff for LD31377.complete
Subject Subject Range Query Range Percent Splice Strand
AP-47-RA 1..1281 259..1539 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:20:29 Download gff for LD31377.complete
Subject Subject Range Query Range Percent Splice Strand
AP-1mu-RA 1..1281 259..1539 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:31:48 Download gff for LD31377.complete
Subject Subject Range Query Range Percent Splice Strand
AP-47-RA 1..1281 259..1539 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:36:15 Download gff for LD31377.complete
Subject Subject Range Query Range Percent Splice Strand
AP-1mu-RA 1..1281 259..1539 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:49:11 Download gff for LD31377.complete
Subject Subject Range Query Range Percent Splice Strand
AP-47-RA 17..1750 1..1734 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:01:20 Download gff for LD31377.complete
Subject Subject Range Query Range Percent Splice Strand
AP-47-RA 17..1750 1..1734 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:20:29 Download gff for LD31377.complete
Subject Subject Range Query Range Percent Splice Strand
AP-1mu-RA 19..1755 1..1737 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:31:48 Download gff for LD31377.complete
Subject Subject Range Query Range Percent Splice Strand
AP-47-RA 17..1750 1..1734 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:36:15 Download gff for LD31377.complete
Subject Subject Range Query Range Percent Splice Strand
AP-1mu-RA 19..1755 1..1737 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 12:36:15 Download gff for LD31377.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9558428..9559507 1..1080 100   Minus
3R 9557712..9558368 1081..1737 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:20:29 Download gff for LD31377.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5384150..5385229 1..1080 100   Minus
arm_3R 5383434..5384090 1081..1737 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:08:23 Download gff for LD31377.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9299259..9300338 1..1080 100   Minus
3R 9298543..9299199 1081..1737 100 <- Minus

LD31377.pep Sequence

Translation from 258 to 1538

> LD31377.pep
MSSSAIFVLDVKGKVLISRNYRGDNIDMAVIDKFMPLLMEREEEGLITPI
LQTAETTFAYIKTNNLYIVSTTPRNKNVNIALVFVFLHKIAQVFVEYFKE
LEEESIRDNFVIIYELLDELLDFGYPQTTDSKILQEYITQEGHKLELQPR
IPVAVTNAVSWRSEGIKYRKNEVFLDVIESVNLLANANGNVLRSEIVGAI
KMRVYLSGMPELRLGLNDKVLFESTGRGKSKSVELEDVKFHQCVRLSRFE
NDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIERHAHSRVEYMIKAK
SQFKRRSTANNVEIVIPVPADADSPKFKTTIGSCKYAPEQNAIIWTIKSF
PGGKEYLMRAHFGLPSVESEDNTEGKPPIQVRFEIPYFTTSGIQVRYLKI
IEKSGYQALPWVRYITQNGDYQLRTN*

LD31377.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 03:39:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16536-PA 426 GF16536-PA 1..426 1..426 2263 100 Plus
Dana\GF23377-PA 437 GF23377-PA 3..437 4..425 873 42 Plus
Dana\GF20328-PA 415 GF20328-PA 4..414 5..424 460 27.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 03:39:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17361-PA 426 GG17361-PA 1..426 1..426 2263 100 Plus
Dere\AP-50-PA 437 GG11137-PA 3..437 4..425 873 42 Plus
Dere\GG17643-PA 415 GG17643-PA 4..414 5..424 461 27.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 03:39:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\AP-47-PA 426 GH19303-PA 1..426 1..426 2247 98.8 Plus
Dgri\GH22222-PA 437 GH22222-PA 3..437 4..425 873 42 Plus
Dgri\GH24272-PA 415 GH24272-PA 4..414 5..424 469 28.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 03:39:11
Subject Length Description Subject Range Query Range Score Percent Strand
AP-1mu-PA 426 CG9388-PA 1..426 1..426 2184 100 Plus
AP-2mu-PC 437 CG7057-PC 5..436 6..424 852 42.2 Plus
AP-2mu-PB 437 CG7057-PB 5..436 6..424 852 42.2 Plus
AP-2mu-PA 437 CG7057-PA 5..436 6..424 852 42.2 Plus
cm-PB 415 CG3035-PB 4..414 5..424 450 27.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 03:39:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23520-PA 426 GI23520-PA 1..426 1..426 2257 99.3 Plus
Dmoj\GI21976-PA 437 GI21976-PA 3..437 4..425 873 42 Plus
Dmoj\GI21579-PA 415 GI21579-PA 4..414 5..424 474 28.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 03:39:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21499-PA 426 GL21499-PA 1..426 1..426 2255 99.1 Plus
Dper\GL24218-PA 437 GL24218-PA 3..437 4..425 873 42 Plus
Dper\GL26809-PA 436 GL26809-PA 4..435 5..424 372 24.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 03:39:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21750-PA 426 GA21750-PA 1..426 1..426 2255 99.1 Plus
Dpse\GA20066-PA 437 GA20066-PA 3..437 4..425 873 42 Plus
Dpse\GA15778-PA 415 GA15778-PA 4..414 5..424 461 28 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 03:39:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26246-PA 426 GM26246-PA 1..426 1..426 2263 100 Plus
Dsec\GM26435-PA 437 GM26435-PA 3..437 4..425 873 42 Plus
Dsec\GM17484-PA 415 GM17484-PA 4..414 5..424 465 28.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 03:39:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20786-PA 426 GD20786-PA 1..426 1..426 2263 100 Plus
Dsim\AP-50-PA 437 GD20952-PA 3..437 4..425 873 42 Plus
Dsim\GD16169-PA 416 GD16169-PA 4..391 5..400 437 28.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 03:39:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10271-PA 426 GJ10271-PA 1..426 1..426 2257 99.3 Plus
Dvir\GJ14336-PA 437 GJ14336-PA 3..437 4..425 873 42 Plus
Dvir\GJ15801-PA 415 GJ15801-PA 4..414 5..424 470 28.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 03:39:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11256-PA 426 GK11256-PA 1..426 1..426 2260 99.5 Plus
Dwil\GK11695-PA 437 GK11695-PA 3..437 4..425 873 42 Plus
Dwil\GK25293-PA 415 GK25293-PA 4..414 5..424 473 28.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 03:39:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24766-PA 426 GE24766-PA 1..426 1..426 2263 100 Plus
Dyak\AP-50-PA 437 GE10302-PA 3..437 4..425 873 42 Plus
Dyak\GE17549-PA 415 GE17549-PA 4..414 5..424 466 28.3 Plus

LD31377.hyp Sequence

Translation from 258 to 1538

> LD31377.hyp
MSSSAIFVLDVKGKVLISRNYRGDNIDMAVIDKFMPLLMEREEEGLITPI
LQTAETTFAYIKTNNLYIVSTTPRNKNVNIALVFVFLHKIAQVFVEYFKE
LEEESIRDNFVIIYELLDELLDFGYPQTTDSKILQEYITQEGHKLELQPR
IPVAVTNAVSWRSEGIKYRKNEVFLDVIESVNLLANANGNVLRSEIVGAI
KMRVYLSGMPELRLGLNDKVLFESTGRGKSKSVELEDVKFHQCVRLSRFE
NDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIERHAHSRVEYMIKAK
SQFKRRSTANNVEIVIPVPADADSPKFKTTIGSCKYAPEQNAIIWTIKSF
PGGKEYLMRAHFGLPSVESEDNTEGKPPIQVRFEIPYFTTSGIQVRYLKI
IEKSGYQALPWVRYITQNGDYQLRTN*

LD31377.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:49:39
Subject Length Description Subject Range Query Range Score Percent Strand
AP-1mu-PA 426 CG9388-PA 1..426 1..426 2184 100 Plus
AP-2mu-PC 437 CG7057-PC 5..436 6..424 852 42.2 Plus
AP-2mu-PB 437 CG7057-PB 5..436 6..424 852 42.2 Plus
AP-2mu-PA 437 CG7057-PA 5..436 6..424 852 42.2 Plus
cm-PB 415 CG3035-PB 4..414 5..424 450 27.4 Plus