Clone LD32088 Report

Search the DGRC for LD32088

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:320
Well:88
Vector:pOT2
Associated Gene/TranscriptCG17806-RA
Protein status:LD32088.pep: gold
Preliminary Size:1684
Sequenced Size:1596

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17806 2001-01-01 Release 2 assignment
CG17806 2001-07-04 Blastp of sequenced clone
CG17806 2008-04-29 Release 5.5 accounting
CG17806 2008-08-15 Release 5.9 accounting
CG17806 2008-12-18 5.12 accounting

Clone Sequence Records

LD32088.complete Sequence

1596 bp (1596 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051810

> LD32088.complete
AACAGAAGTCCAACTTTGTTTACTTGGCGGAAACTAAACAATTGAGTTGA
AACTGCAAAAAGGATGACCACGCTGTGCCGCACCTGTGGCCAGGAGGCGG
AGCACGCCAAGTCACTTTTCGATAAGGAGGCCAGAGATGTCCTGAGCAAC
ATCCTCAAGCTGACGGGCTTTTGGTTGAGGAACCAGCCAGGTGTGCCAAC
GAGGATCTGCTTATCCTGCTTGCTGGATCTGAACGATGCCATCGCATTCC
GGGAGCGCTGCATCAGGACCAATTCGTCTTGGTTCGAAAAGCAGGGCAAA
CAAGAGGATTCGGACACTGAGACTGCAAGGGAAGGCGGGAATAACAGGTT
AGAAAGTAGGGTGGATGTTATGCCCATTAGTATTGCACAGCCGCAAAGGA
GAAGGATTCTACCACAACGCAGCAAGAAAGTGGATGGAGTGCCTCTTAAG
ACAGTAGAAACCCCAATTTACCCTTTAGTTGTCCCGGAAATACCGCCTGC
CGATCTCGTCGATCCTCTCCGGTGCGAGGATCCTATTCAGGTGAAGAGCG
AGCCTCAGCTTTCATCTGATTATCCAGTGGAGTCCATGAATCACGAAGAG
CCAGCATCCGAAATGCCCCAAGTCATGAAGGAAGAGCCCAGAACACTACA
AGTCATCGGGGAAGTACAGAAAAACCGAAGAAAACCGAGGAGCAAAGGGT
GCTTAGAGGAGTGTCCTGGCAAGGACATGGCTAAAATAGAGAATATTGAC
TCAACTACCAATAAGACCAAAGAGGAAAAGTATGCCACACGAAACAAATG
GGGAGCTGCCAAAAGAGCCTATGCACTGGAGCACCGACTATATTTCTGCG
ACCAATGCGGCAAAACTTTTAGCGAGAAGGGCAACTTCAATGTGCACCTC
AGACGGCACAAGGGCACCAAGGAGTTCCAGTGCCAGGAGTGCGACCGCAT
GGAGTTCACCCAACACCTGCTCAATTTGCACGTGCGGATTAAGCATCGCG
GGGAGCTGCCCTACGTGTGCAAGTACTGCGGCAAGCGATTTGACAACTGC
CTCAAGCGGCTGAACCACGAGCGCAACCACAAGGAGAGTCCCGTCCACCG
ACCACACGTGTGCTCCACATGCCAGAAGGCCTTCAAGACTTCGACGGCTC
TCAAGGACCACATCGTGGTCCACACGGGGGAACAGCCATTCCACTGCGAG
CTCTGCCAAACGTTCTTCAATAGAAGGAACGCCCTGGCCACCCACTACAA
GTCGAAGCACCATCGCCTGAAAGTTGAGGAGCAGTCAAAAATGCCAAAAA
TGGATGCTACTGTCCAAGCGGATGGGTAAATCGTTGGTTCCTTGAGAGGA
TTATTTCGCATGTTCTGCTATTGACATGCAAAATGCCCCTCTGGAAACTT
TCTAAAGTTGATGTCAATAAAAATTGGTTACAAATTGCTCCCTCATCCAA
GCTGAGTAACGGGTATCTGATAGTCGAGGACTCGACTATCTTCCCTTGTT
TCCTAATAAGATATGGCATAGCAGTAAATTGTGGTTTTGCTAACATCAAT
AATTTTCAATAAAGAATATAATTAAAATAAAAAAAAAAAAAAAAAA

LD32088.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:59:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG17806-RA 1587 CG17806-RA 4..1583 1..1580 7900 100 Plus
CG17802-RA 1796 CG17802-RA 1715..1796 1..82 410 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:47:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 13626343..13627362 1193..174 5100 100 Minus
chr3R 27901430 chr3R 13625902..13626286 1578..1194 1925 100 Minus
chr3R 27901430 chr3R 13627412..13627585 174..1 870 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:47:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG17806-RA 1266 CG17806-PA 1..1266 64..1329 6330 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:26:01 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:47:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG17806-RA 1613 CG17806-RA 32..1609 1..1578 7890 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:47:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG17806-PA 421 CG17806-PA 1..421 64..1326 2276 100 Plus
CG17802-PA 439 CG17802-PA 1..436 64..1308 510 29.8 Plus
CG18764-PA 409 CG18764-PA 1..400 64..1278 468 30 Plus
ranshi-PA 346 CG9793-PA 5..338 73..1281 446 29.1 Plus
CG8159-PB 399 CG8159-PB 2..334 64..1281 428 28.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:47:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17801987..17803006 1193..174 5100 100 Minus
3R 32079331 3R 17801544..17801930 1580..1194 1935 100 Minus
3R 32079331 3R 17803056..17803229 174..1 870 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:18:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17542818..17543837 1193..174 5100 100 Minus
3R 31820162 3R 17542375..17542761 1580..1194 1935 100 Minus
3R 31820162 3R 17543887..17544060 174..1 870 100 Minus
Blast to na_te.dros performed 2014-11-27 15:47:48
Subject Length Description Subject Range Query Range Score Percent Strand
INE-1 611 INE-1 INE1 611bp Derived from U66884 (e1371475) (Rel. 52, Last updated, Version 6). 505..585 1408..1489 199 77.4 Plus

LD32088.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:37:05 Download gff for LD32088.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 13627412..13627585 1..174 100   Minus
chr3R 13626343..13627361 175..1193 100 <- Minus
chr3R 13625902..13626286 1194..1578 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:13:33 Download gff for LD32088.complete
Subject Subject Range Query Range Percent Splice Strand
CG17806-RA 1..1266 64..1329 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:59:27 Download gff for LD32088.complete
Subject Subject Range Query Range Percent Splice Strand
CG17806-RA 1..1266 64..1329 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:08:02 Download gff for LD32088.complete
Subject Subject Range Query Range Percent Splice Strand
CG17806-RA 1..1266 64..1329 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:43:00 Download gff for LD32088.complete
Subject Subject Range Query Range Percent Splice Strand
CG17806-RA 1..1266 64..1329 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:37:05 Download gff for LD32088.complete
Subject Subject Range Query Range Percent Splice Strand
CG17806-RA 1..1266 64..1329 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:14:33 Download gff for LD32088.complete
Subject Subject Range Query Range Percent Splice Strand
CG17806-RA 1..1578 1..1578 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:59:27 Download gff for LD32088.complete
Subject Subject Range Query Range Percent Splice Strand
CG17806-RA 1..1578 1..1578 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:08:02 Download gff for LD32088.complete
Subject Subject Range Query Range Percent Splice Strand
CG17806-RA 32..1609 1..1578 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:43:00 Download gff for LD32088.complete
Subject Subject Range Query Range Percent Splice Strand
CG17806-RA 1..1578 1..1578 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:37:05 Download gff for LD32088.complete
Subject Subject Range Query Range Percent Splice Strand
CG17806-RA 32..1609 1..1578 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:37:05 Download gff for LD32088.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17803056..17803229 1..174 100   Minus
3R 17801987..17803005 175..1193 100 <- Minus
3R 17801546..17801930 1194..1578 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:08:02 Download gff for LD32088.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13628778..13628951 1..174 100   Minus
arm_3R 13627709..13628727 175..1193 100 <- Minus
arm_3R 13627268..13627652 1194..1578 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:26:08 Download gff for LD32088.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17543887..17544060 1..174 100   Minus
3R 17542818..17543836 175..1193 100 <- Minus
3R 17542377..17542761 1194..1578 100 <- Minus

LD32088.pep Sequence

Translation from 63 to 1328

> LD32088.pep
MTTLCRTCGQEAEHAKSLFDKEARDVLSNILKLTGFWLRNQPGVPTRICL
SCLLDLNDAIAFRERCIRTNSSWFEKQGKQEDSDTETAREGGNNRLESRV
DVMPISIAQPQRRRILPQRSKKVDGVPLKTVETPIYPLVVPEIPPADLVD
PLRCEDPIQVKSEPQLSSDYPVESMNHEEPASEMPQVMKEEPRTLQVIGE
VQKNRRKPRSKGCLEECPGKDMAKIENIDSTTNKTKEEKYATRNKWGAAK
RAYALEHRLYFCDQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDRMEFTQ
HLLNLHVRIKHRGELPYVCKYCGKRFDNCLKRLNHERNHKESPVHRPHVC
STCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFNRRNALATHYKSKHH
RLKVEEQSKMPKMDATVQADG*

LD32088.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 05:49:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18168-PA 364 GF18168-PA 1..354 1..408 814 45.2 Plus
Dana\GF18186-PA 409 GF18186-PA 5..343 4..406 394 28.2 Plus
Dana\GF18383-PA 412 GF18383-PA 262..408 262..411 363 42.7 Plus
Dana\GF16841-PA 430 GF16841-PA 262..413 259..414 319 39.7 Plus
Dana\GF22975-PA 367 GF22975-PA 199..335 261..400 317 43.6 Plus
Dana\GF18383-PA 412 GF18383-PA 1..71 1..69 162 47.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 05:49:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16750-PA 430 GG16750-PA 1..430 1..421 1767 78.1 Plus
Dere\GG18288-PA 425 GG18288-PA 1..423 1..407 436 29.9 Plus
Dere\GG16749-PA 448 GG16749-PA 279..433 250..403 392 45.8 Plus
Dere\GG17430-PA 347 GG17430-PA 5..335 4..404 370 29.5 Plus
Dere\GG11820-PA 361 GG11820-PA 6..356 5..420 331 27.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 05:49:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22317-PA 451 GH22317-PA 6..415 4..401 478 30.5 Plus
Dgri\GH18112-PA 426 GH18112-PA 1..417 1..400 451 29.4 Plus
Dgri\GH19016-PA 442 GH19016-PA 9..413 1..405 392 28.5 Plus
Dgri\GH18576-PA 371 GH18576-PA 1..357 4..404 342 27.8 Plus
Dgri\GH18577-PA 386 GH18577-PA 199..346 259..410 320 40.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 05:49:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG17806-PA 421 CG17806-PA 1..421 1..421 2276 100 Plus
CG17802-PA 439 CG17802-PA 1..436 1..415 510 29.8 Plus
CG18764-PA 409 CG18764-PA 1..400 1..405 468 30 Plus
ranshi-PA 346 CG9793-PA 5..338 4..406 446 29.1 Plus
CG8159-PB 399 CG8159-PB 2..334 1..406 428 28.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 05:49:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22983-PA 389 GI22983-PA 2..382 3..421 480 30.3 Plus
Dmoj\GI10370-PA 703 GI10370-PA 2..384 1..405 404 29.8 Plus
Dmoj\GI22985-PA 652 GI22985-PA 192..563 5..385 373 28.7 Plus
Dmoj\GI24613-PA 425 GI24613-PA 272..411 261..403 369 45.5 Plus
Dmoj\GI22984-PA 559 GI22984-PA 1..422 1..413 342 26.2 Plus
Dmoj\GI10370-PA 703 GI10370-PA 517..697 221..409 312 37.6 Plus
Dmoj\GI22985-PA 652 GI22985-PA 528..644 290..410 190 33.9 Plus
Dmoj\GI24613-PA 425 GI24613-PA 1..118 1..111 158 38.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 05:49:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22110-PA 296 GL22110-PA 132..296 258..421 525 57.6 Plus
Dper\GL12614-PA 349 GL12614-PA 188..339 260..408 393 46.7 Plus
Dper\GL12613-PA 364 GL12613-PA 1..338 1..404 386 30 Plus
Dper\GL23638-PA 343 GL23638-PA 1..320 26..400 383 29.7 Plus
Dper\GL22114-PA 400 GL22114-PA 255..397 262..407 354 43.2 Plus
Dper\GL12614-PA 349 GL12614-PA 1..164 1..149 158 27.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 05:49:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27381-PB 385 GA27381-PB 1..380 1..420 746 39.3 Plus
Dpse\GA15068-PA 400 GA15068-PA 1..397 1..407 447 30.9 Plus
Dpse\GA20291-PA 364 GA20291-PA 1..338 1..404 395 30 Plus
Dpse\GA27571-PA 349 GA27571-PA 188..339 260..408 393 46.7 Plus
Dpse\GA14725-PA 375 GA14725-PA 216..352 261..400 328 45 Plus
Dpse\GA27571-PA 349 GA27571-PA 1..164 1..149 158 27.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 05:49:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15336-PA 414 GM15336-PA 1..414 1..421 1957 89.6 Plus
Dsec\GM26322-PA 346 GM26322-PA 1..343 4..418 390 27.4 Plus
Dsec\GM15335-PA 473 GM15335-PA 263..411 250..397 372 44.3 Plus
Dsec\GM23960-PA 412 GM23960-PA 263..402 262..404 335 42 Plus
Dsec\GM23759-PA 399 GM23759-PA 191..334 259..406 313 39.9 Plus
Dsec\GM23960-PA 412 GM23960-PA 1..71 1..69 153 47.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 05:49:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20210-PA 420 GD20210-PA 1..420 1..421 2059 91.7 Plus
Dsim\GD20209-PA 426 GD20209-PA 263..409 250..401 377 44.7 Plus
Dsim\GD18769-PA 413 GD18769-PA 264..403 262..404 334 42 Plus
Dsim\GD20849-PA 397 GD20849-PA 130..378 155..400 324 32.8 Plus
Dsim\GD18570-PA 399 GD18570-PA 150..334 220..406 320 35.4 Plus
Dsim\GD18769-PA 413 GD18769-PA 1..71 1..69 153 47.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 05:49:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24681-PA 402 GJ24681-PA 5..374 3..406 495 31.7 Plus
Dvir\GJ22564-PA 424 GJ22564-PA 1..413 1..403 469 29.8 Plus
Dvir\GJ17106-PA 382 GJ17106-PA 6..367 4..401 455 30.1 Plus
Dvir\GJ24586-PA 743 GJ24586-PA 2..395 1..414 415 29 Plus
Dvir\GJ24679-PA 423 GJ24679-PA 1..393 1..409 396 28.5 Plus
Dvir\GJ24586-PA 743 GJ24586-PA 391..740 35..412 321 26 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 05:49:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13271-PA 363 GK13271-PA 1..360 1..409 592 37.5 Plus
Dwil\GK11090-PA 394 GK11090-PA 1..391 1..416 483 30.2 Plus
Dwil\GK11270-PA 359 GK11270-PA 3..345 4..401 356 27.3 Plus
Dwil\GK11271-PA 440 GK11271-PA 275..432 259..420 332 40.1 Plus
Dwil\GK11276-PA 396 GK11276-PA 222..368 259..410 324 44.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 05:49:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25245-PA 440 GE25245-PA 1..440 1..421 1678 76.4 Plus
Dyak\GE24186-PA 431 GE24186-PA 1..421 1..404 458 30.3 Plus
Dyak\GE25244-PA 447 GE25244-PA 278..444 250..415 395 43.7 Plus
Dyak\GE24830-PA 418 GE24830-PA 250..392 259..405 318 41.5 Plus
Dyak\GE25901-PA 373 GE25901-PA 2..324 1..405 317 25.1 Plus

LD32088.hyp Sequence

Translation from 63 to 1328

> LD32088.hyp
MTTLCRTCGQEAEHAKSLFDKEARDVLSNILKLTGFWLRNQPGVPTRICL
SCLLDLNDAIAFRERCIRTNSSWFEKQGKQEDSDTETAREGGNNRLESRV
DVMPISIAQPQRRRILPQRSKKVDGVPLKTVETPIYPLVVPEIPPADLVD
PLRCEDPIQVKSEPQLSSDYPVESMNHEEPASEMPQVMKEEPRTLQVIGE
VQKNRRKPRSKGCLEECPGKDMAKIENIDSTTNKTKEEKYATRNKWGAAK
RAYALEHRLYFCDQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDRMEFTQ
HLLNLHVRIKHRGELPYVCKYCGKRFDNCLKRLNHERNHKESPVHRPHVC
STCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFNRRNALATHYKSKHH
RLKVEEQSKMPKMDATVQADG*

LD32088.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:35:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG17806-PA 421 CG17806-PA 1..421 1..421 2276 100 Plus
CG17802-PA 439 CG17802-PA 1..436 1..415 510 29.8 Plus
CG18764-PA 409 CG18764-PA 1..400 1..405 468 30 Plus
ranshi-PA 346 CG9793-PA 5..338 4..406 446 29.1 Plus
CG8159-PB 399 CG8159-PB 2..334 1..406 428 28.3 Plus