Clone LD32747 Report

Search the DGRC for LD32747

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:327
Well:47
Vector:pOT2
Associated Gene/TranscriptCG15436-RA
Protein status:LD32747.pep: gold
Preliminary Size:1503
Sequenced Size:1408

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15436 2001-01-01 Release 2 assignment
CG15436 2001-07-04 Blastp of sequenced clone
CG15436 2003-01-01 Sim4 clustering to Release 3
CG15436 2008-04-29 Release 5.5 accounting
CG15436 2008-08-15 Release 5.9 accounting
CG15436 2008-12-18 5.12 accounting

Clone Sequence Records

LD32747.complete Sequence

1408 bp (1408 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051819

> LD32747.complete
ACAATGTGAAGTTTAGCTTATTATTATTTTGAATTGTTCATCAAGGCAAT
CGCATTAATTTTCAATTAATTGGGATGTATGAAACGGATTCCTAAATTAT
AAAAGATTGCTTTTCCAGCTATAAGCTATTTAGTATATACATCAGGGATA
ATGGCGGAAATATGCCGAGTTTGTATGGATATTTCTGGTAAACTCGTTAA
CATATTTGACGCCAGACGAAGAACCAGAGTTTCCATTGCCGAGATGATCG
CGCAGTGCACCGGATTCGAGGTCAAACGTGGCGATTTGTTTTCGGAAATG
ATATGCCCACAGTGCTATGAGGACGTAAAGAGCGCGTATGGGATAAGGCA
AACTTGTGAGGAAAGCCACCAGTTCTACTGCCGAGTTCGCGATGAAGGCA
TCGAGGATGCTTTATGCGCCTTGCTCGAAGAAGAAGACTGGGAGATTTCG
GAAGACGAAGATGCGCGGATTGATTCTGCATCCGCTGCTGATGACGATGG
GAAAAGCGACAGCAAGAAGGTAGCATTCGAATGTCGAGAATGCCACAAGA
AATACCAGCGAAAGGGAACTTTTCTGAGGCACATGCGAACACACATGGAC
GGACAATCCTTCCCATGCCCCTACTGCAAGCGGAACTTTAGACTTAGAGT
CACTCTCAAGGCGCACATGAAGACCCACAATGCAGCGAAACCCTACGAGT
GTTCCCACTGCGCCAAGACCTTTGCGCAGCAGTCCACTCTGCAGTCGCAT
GAGCGAACTCACACTGGCGAACGACCATTCAAGTGTTCACAGTGCTCAAA
AACCTTTATTAAATCATCCGATCTCCGGCGTCACATCCGCACACATGGCA
GCGAGAGACCGTTCAAGTGCTCCAAGTGCACGAAAACATTTACGAGGAAG
TTTCACCTTGATAACCATTTCCGTTCTCACACTGGTGAACGACCATTCAA
GTGTTCCCACTGCCCCAAGGCCTTCGCTATGAAGCAGCACCTCAAGCAGC
ACAGCCGCCTGCACTTACCAGATCGTCCATTTCGCTGCTCCCACTGTCCC
AAGACTTTTCGGCTGAGCAGCACTCTCAAGGAGCACAAGCTCGTACACAA
CGCTGAAAGAACATTTAAGTGTCCTCACTGTGCCAGTTTCTATAAGCAGA
GAAAAACACTTGCTAGACATATCCTCGAGATACACAAGTGACCACTACTT
TAAAAACACTTGGAAGACATATCTTCCATGTGCACTACTTTAAAATGGAC
AAAAATGATTTTGCTAGATGATAAAATAAGCTAACATATTCATAGGTATT
GTAAGAATAAGGCATAAAATTGGTTGGTAATGAATATGCCTATTTTGATA
TGTTTTATGATGGAATAAAATGTTATTTATAAAAAAATAAAAAAAAAAAA
AAAAAAAA

LD32747.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:30:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG15436-RA 1461 CG15436-RA 65..1445 1..1381 6905 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 23:49:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 4462969..4464207 143..1381 6150 99.8 Plus
chr2L 23010047 chr2L 4462773..4462918 1..146 685 97.9 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 23:49:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG15436-RA 1041 CG15436-PA 1..1041 151..1191 5205 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:26:48 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:49:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG15436-RA 1411 CG15436-RA 32..1411 1..1380 6900 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:49:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG15436-PA 346 CG15436-PA 1..346 151..1188 1658 100 Plus
CG5245-PA 501 CG5245-PA 82..297 526..1179 571 44.5 Plus
CG5245-PA 501 CG5245-PA 165..381 526..1179 538 42.7 Plus
crol-PC 756 CG14938-PC 184..398 529..1173 523 42.3 Plus
crol-PB 891 CG14938-PB 390..604 529..1173 523 42.3 Plus
crol-PG 878 CG14938-PG 305..520 526..1173 522 41.7 Plus
CG5245-PA 501 CG5245-PA 221..435 526..1173 520 41.7 Plus
CG5245-PA 501 CG5245-PA 63..270 535..1185 518 43.3 Plus
crol-PC 756 CG14938-PC 211..430 526..1185 511 39.5 Plus
crol-PB 891 CG14938-PB 417..636 526..1185 511 39.5 Plus
crol-PC 756 CG14938-PC 295..519 526..1185 478 39.1 Plus
CG5245-PA 501 CG5245-PA 248..491 526..1173 477 35.7 Plus
crol-PB 891 CG14938-PB 249..464 526..1173 474 37.5 Plus
crol-PB 891 CG14938-PB 363..576 532..1173 474 37.4 Plus
crol-PB 891 CG14938-PB 333..548 526..1173 467 36.6 Plus
crol-PB 891 CG14938-PB 475..679 532..1131 460 40.5 Plus
crol-PB 891 CG14938-PB 305..520 526..1173 456 35.6 Plus
crol-PB 891 CG14938-PB 277..492 526..1173 448 35.2 Plus
crol-PB 891 CG14938-PB 501..683 526..1059 429 42.1 Plus
crol-PB 891 CG14938-PB 223..437 532..1176 421 34.9 Plus
crol-PC 756 CG14938-PC 182..342 691..1173 391 39.8 Plus
CG5245-PA 501 CG5245-PA 332..492 526..1008 390 41 Plus
crol-PC 756 CG14938-PC 353..521 532..1023 355 39.6 Plus
crol-PC 756 CG14938-PC 161..314 712..1173 328 37 Plus
crol-PB 891 CG14938-PB 217..375 682..1170 296 36.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 23:49:50
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4463838..4465076 143..1381 6195 100 Plus
2L 23513712 2L 4463642..4463787 1..146 730 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:52:55
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4463838..4465076 143..1381 6195 100 Plus
2L 23513712 2L 4463642..4463787 1..146 730 100 Plus
Blast to na_te.dros performed on 2014-11-26 23:49:52 has no hits.

LD32747.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:23:05 Download gff for LD32747.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 4462972..4464207 146..1381 99   Plus
chr2L 4462773..4462917 1..145 97 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:14:21 Download gff for LD32747.complete
Subject Subject Range Query Range Percent Splice Strand
CG15436-RA 1..1041 151..1191 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:19:00 Download gff for LD32747.complete
Subject Subject Range Query Range Percent Splice Strand
CG15436-RA 1..1041 151..1191 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:20:22 Download gff for LD32747.complete
Subject Subject Range Query Range Percent Splice Strand
CG15436-RA 1..1041 151..1191 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:50:35 Download gff for LD32747.complete
Subject Subject Range Query Range Percent Splice Strand
CG15436-RA 1..1041 151..1191 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:23:05 Download gff for LD32747.complete
Subject Subject Range Query Range Percent Splice Strand
CG15436-RA 1..1041 151..1191 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:14:33 Download gff for LD32747.complete
Subject Subject Range Query Range Percent Splice Strand
CG15436-RA 1..1386 1..1386 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:19:00 Download gff for LD32747.complete
Subject Subject Range Query Range Percent Splice Strand
CG15436-RA 1..1380 1..1380 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:20:22 Download gff for LD32747.complete
Subject Subject Range Query Range Percent Splice Strand
CG15436-RA 32..1411 1..1380 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:50:35 Download gff for LD32747.complete
Subject Subject Range Query Range Percent Splice Strand
CG15436-RA 1..1386 1..1386 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:23:05 Download gff for LD32747.complete
Subject Subject Range Query Range Percent Splice Strand
CG15436-RA 32..1411 1..1380 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:23:05 Download gff for LD32747.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4463841..4465076 146..1381 100   Plus
2L 4463642..4463786 1..145 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:20:22 Download gff for LD32747.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4463841..4465076 146..1381 100   Plus
arm_2L 4463642..4463786 1..145 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:28:55 Download gff for LD32747.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4463841..4465076 146..1381 100   Plus
2L 4463642..4463786 1..145 100 -> Plus

LD32747.pep Sequence

Translation from 150 to 1190

> LD32747.pep
MAEICRVCMDISGKLVNIFDARRRTRVSIAEMIAQCTGFEVKRGDLFSEM
ICPQCYEDVKSAYGIRQTCEESHQFYCRVRDEGIEDALCALLEEEDWEIS
EDEDARIDSASAADDDGKSDSKKVAFECRECHKKYQRKGTFLRHMRTHMD
GQSFPCPYCKRNFRLRVTLKAHMKTHNAAKPYECSHCAKTFAQQSTLQSH
ERTHTGERPFKCSQCSKTFIKSSDLRRHIRTHGSERPFKCSKCTKTFTRK
FHLDNHFRSHTGERPFKCSHCPKAFAMKQHLKQHSRLHLPDRPFRCSHCP
KTFRLSSTLKEHKLVHNAERTFKCPHCASFYKQRKTLARHILEIHK*

LD32747.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 05:19:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10403-PA 578 GF10403-PA 293..509 126..340 430 37.3 Plus
Dana\GF20022-PA 182 GF20022-PA 1..172 145..316 429 47.1 Plus
Dana\GF23400-PA 940 GF23400-PA 387..611 121..345 428 40 Plus
Dana\GF10403-PA 578 GF10403-PA 320..541 125..341 415 37.4 Plus
Dana\GF10403-PA 578 GF10403-PA 267..481 128..342 415 38.6 Plus
Dana\GF17155-PA 388 GF17155-PA 1..378 1..346 415 29.5 Plus
Dana\GF23400-PA 940 GF23400-PA 247..467 121..341 407 37.1 Plus
Dana\GF23400-PA 940 GF23400-PA 366..579 128..341 402 38.8 Plus
Dana\GF20022-PA 182 GF20022-PA 1..169 173..341 400 43.2 Plus
Dana\GF23400-PA 940 GF23400-PA 412..635 118..340 395 38.4 Plus
Dana\GF23400-PA 940 GF23400-PA 478..696 128..341 391 39.3 Plus
Dana\GF23400-PA 940 GF23400-PA 324..551 114..341 388 35.1 Plus
Dana\GF20022-PA 182 GF20022-PA 10..172 126..288 382 47.2 Plus
Dana\GF15824-PA 738 GF15824-PA 283..513 115..345 382 33.2 Plus
Dana\GF23400-PA 940 GF23400-PA 300..523 118..341 376 35.3 Plus
Dana\GF23400-PA 940 GF23400-PA 271..495 117..341 375 34.7 Plus
Dana\GF10403-PA 578 GF10403-PA 226..423 150..340 352 38.4 Plus
Dana\GF23400-PA 940 GF23400-PA 193..440 104..342 352 32.3 Plus
Dana\GF10403-PA 578 GF10403-PA 377..575 126..320 332 35 Plus
Dana\GF23400-PA 940 GF23400-PA 534..702 128..291 302 39.6 Plus
Dana\GF20022-PA 182 GF20022-PA 38..173 126..261 292 42.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 05:19:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25008-PA 615 GG25008-PA 293..615 24..346 1418 81.7 Plus
Dere\GG24456-PA 348 GG24456-PA 1..335 1..312 516 35.7 Plus
Dere\GG13562-PA 298 GG13562-PA 5..296 4..288 515 37.7 Plus
Dere\GG13232-PA 308 GG13232-PA 1..293 15..316 501 38.3 Plus
Dere\GG16687-PA 410 GG16687-PA 1..372 32..340 500 33.1 Plus
Dere\GG25008-PA 615 GG25008-PA 146..289 175..320 333 45.2 Plus
Dere\GG25008-PA 615 GG25008-PA 153..289 154..292 314 43.9 Plus
Dere\GG25008-PA 615 GG25008-PA 150..282 207..341 299 43.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 05:19:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10681-PA 355 GH10681-PA 1..346 1..340 546 33.4 Plus
Dgri\GH13680-PA 384 GH13680-PA 1..379 1..316 512 31.8 Plus
Dgri\GH13049-PA 345 GH13049-PA 1..330 1..341 482 31.3 Plus
Dgri\GH10788-PA 338 GH10788-PA 16..287 86..346 429 35 Plus
Dgri\GH17091-PA 444 GH17091-PA 1..399 1..341 420 28.6 Plus
Dgri\GH13049-PA 345 GH13049-PA 194..336 121..263 296 37.1 Plus
Dgri\GH13680-PA 384 GH13680-PA 180..292 229..341 249 38.9 Plus
Dgri\GH10681-PA 355 GH10681-PA 233..352 115..234 226 35 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 05:19:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG15436-PA 346 CG15436-PA 1..346 1..346 1906 100 Plus
Neu2-PA 382 CG7204-PA 1..320 15..341 527 34 Plus
CG5245-PA 501 CG5245-PA 185..435 118..341 523 38.1 Plus
CG44002-PA 345 CG44002-PA 1..338 1..292 517 33.4 Plus
Neu2-PB 308 CG7204-PB 1..276 15..312 514 36.1 Plus
Neu2-PA 382 CG7204-PA 231..376 126..263 229 31.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 05:19:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11127-PA 384 GI11127-PA 1..351 1..342 588 36.5 Plus
Dmoj\GI17965-PA 403 GI17965-PA 1..397 1..341 489 28.7 Plus
Dmoj\GI13598-PA 345 GI13598-PA 1..336 1..322 474 35.1 Plus
Dmoj\GI17692-PA 965 GI17692-PA 400..624 121..345 427 40 Plus
Dmoj\GI17300-PA 323 GI17300-PA 10..277 79..346 419 34.2 Plus
Dmoj\GI17965-PA 403 GI17965-PA 261..401 121..261 283 39.7 Plus
Dmoj\GI11127-PA 384 GI11127-PA 267..382 118..233 211 35.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 05:19:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20489-PA 360 GL20489-PA 1..351 1..340 763 43 Plus
Dper\GL26275-PA 880 GL26275-PA 272..629 1..341 740 40.7 Plus
Dper\GL20556-PA 429 GL20556-PA 1..346 1..341 733 41.8 Plus
Dper\GL20492-PA 419 GL20492-PA 1..376 1..342 721 39.5 Plus
Dper\GL16049-PA 324 GL16049-PA 1..315 1..312 660 42.1 Plus
Dper\GL26275-PA 880 GL26275-PA 5..269 29..303 591 41.1 Plus
Dper\GL26275-PA 880 GL26275-PA 552..820 126..341 478 37.5 Plus
Dper\GL26275-PA 880 GL26275-PA 488..715 118..341 422 36.4 Plus
Dper\GL26275-PA 880 GL26275-PA 633..848 119..313 388 38 Plus
Dper\GL20489-PA 360 GL20489-PA 192..355 125..288 371 40.9 Plus
Dper\GL20556-PA 429 GL20556-PA 128..265 208..345 327 44.2 Plus
Dper\GL20492-PA 419 GL20492-PA 128..265 208..345 326 44.2 Plus
Dper\GL26275-PA 880 GL26275-PA 688..863 118..263 300 37.5 Plus
Dper\GL20489-PA 360 GL20489-PA 221..356 126..261 281 38.2 Plus
Dper\GL20489-PA 360 GL20489-PA 121..240 238..341 235 40 Plus
Dper\GL20489-PA 360 GL20489-PA 241..355 118..232 225 39.1 Plus
Dper\GL26275-PA 880 GL26275-PA 78..166 252..340 177 42.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 05:19:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25545-PB 362 GA25545-PB 1..353 1..340 754 42.2 Plus
Dpse\GA26117-PA 423 GA26117-PA 1..387 9..341 682 35.4 Plus
Dpse\GA28105-PA 389 GA28105-PA 73..374 1..312 669 42.9 Plus
Dpse\GA25534-PA 412 GA25534-PA 1..390 1..342 665 36.6 Plus
Dpse\GA25549-PA 308 GA25549-PA 1..307 1..304 663 42 Plus
Dpse\GA26117-PA 423 GA26117-PA 200..414 126..340 486 41.4 Plus
Dpse\GA26117-PA 423 GA26117-PA 228..419 126..317 417 40.1 Plus
Dpse\GA25545-PB 362 GA25545-PB 194..357 125..288 370 40.9 Plus
Dpse\GA25545-PB 362 GA25545-PB 223..358 126..261 281 38.2 Plus
Dpse\GA25545-PB 362 GA25545-PB 101..242 192..341 269 40.1 Plus
Dpse\GA25545-PB 362 GA25545-PB 243..357 118..232 224 39.1 Plus
Dpse\GA28105-PA 389 GA28105-PA 174..262 252..340 182 42.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 05:19:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18478-PA 345 GM18478-PA 1..345 1..346 1621 90.8 Plus
Dsec\GM18162-PA 418 GM18162-PA 1..412 15..346 569 33.7 Plus
Dsec\GM24032-PA 495 GM24032-PA 81..297 125..343 467 42.9 Plus
Dsec\GM24032-PA 495 GM24032-PA 185..409 118..343 465 42 Plus
Dsec\GM24032-PA 495 GM24032-PA 189..435 93..341 465 40.2 Plus
Dsec\GM24571-PA 575 GM24571-PA 291..508 125..340 450 39.9 Plus
Dsec\GM23822-PA 383 GM23822-PA 1..374 1..346 440 30 Plus
Dsec\GM24571-PA 575 GM24571-PA 266..480 128..342 426 38.6 Plus
Dsec\GM24032-PA 495 GM24032-PA 247..495 125..345 400 36.1 Plus
Dsec\GM24032-PA 495 GM24032-PA 139..381 128..343 397 38.1 Plus
Dsec\GM24571-PA 575 GM24571-PA 321..568 127..341 381 33.7 Plus
Dsec\GM24571-PA 575 GM24571-PA 228..422 150..340 380 39.5 Plus
Dsec\GM24032-PA 495 GM24032-PA 324..492 118..286 345 40.8 Plus
Dsec\GM24032-PA 495 GM24032-PA 301..490 123..312 333 36.3 Plus
Dsec\GM18162-PA 418 GM18162-PA 246..418 123..295 324 37.6 Plus
Dsec\GM24032-PA 495 GM24032-PA 59..241 181..342 306 39.2 Plus
Dsec\GM24571-PA 575 GM24571-PA 375..571 125..288 283 32.8 Plus
Dsec\GM24571-PA 575 GM24571-PA 234..339 240..341 151 32.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 05:19:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22772-PA 392 GD22772-PA 1..390 15..346 573 34.5 Plus
Dsim\GD12116-PA 360 GD12116-PA 1..281 15..318 478 36.2 Plus
Dsim\GD18833-PA 438 GD18833-PA 122..346 118..343 463 42.5 Plus
Dsim\GD18833-PA 438 GD18833-PA 126..372 93..341 461 40.2 Plus
Dsim\GD18633-PA 383 GD18633-PA 1..374 1..346 458 30.3 Plus
Dsim\GD18833-PA 438 GD18833-PA 21..234 125..343 445 42.9 Plus
Dsim\GD22773-PA 325 GD22773-PA 1..316 15..346 442 32.2 Plus
Dsim\GD18833-PA 438 GD18833-PA 184..432 125..345 407 36.9 Plus
Dsim\GD18833-PA 438 GD18833-PA 32..318 79..343 397 35.2 Plus
Dsim\GD18833-PA 438 GD18833-PA 261..429 118..286 350 41.4 Plus
Dsim\GD12116-PA 360 GD12116-PA 115..250 207..341 303 44.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 05:19:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18319-PA 411 GJ18319-PA 1..377 1..341 538 33.5 Plus
Dvir\GJ11385-PA 430 GJ11385-PA 1..407 1..341 519 31.2 Plus
Dvir\GJ16305-PA 405 GJ16305-PA 1..397 1..341 515 30.1 Plus
Dvir\GJ11512-PA 511 GJ11512-PA 1..370 1..338 468 32.4 Plus
Dvir\GJ13935-PA 362 GJ13935-PA 1..343 1..316 451 33.2 Plus
Dvir\GJ11512-PA 511 GJ11512-PA 155..375 92..313 372 36.3 Plus
Dvir\GJ16305-PA 405 GJ16305-PA 238..400 126..288 369 42.3 Plus
Dvir\GJ11385-PA 430 GJ11385-PA 233..410 131..288 307 37.1 Plus
Dvir\GJ18319-PA 411 GJ18319-PA 259..409 111..261 304 40.4 Plus
Dvir\GJ11512-PA 511 GJ11512-PA 216..472 126..340 247 30.4 Plus
Dvir\GJ16305-PA 405 GJ16305-PA 291..401 123..233 205 35.1 Plus
Dvir\GJ11512-PA 511 GJ11512-PA 190..291 238..341 185 37.5 Plus
Dvir\GJ18319-PA 411 GJ18319-PA 151..237 258..345 156 38.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 05:19:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10434-PA 367 GK10434-PA 67..295 118..345 448 38.7 Plus
Dwil\GK10434-PA 367 GK10434-PA 49..263 128..342 433 36.7 Plus
Dwil\GK14973-PA 1011 GK14973-PA 418..641 118..341 431 39.3 Plus
Dwil\GK13252-PA 418 GK13252-PA 11..399 3..318 426 27.7 Plus
Dwil\GK14973-PA 1011 GK14973-PA 456..673 128..345 417 40.8 Plus
Dwil\GK14973-PA 1011 GK14973-PA 393..613 121..341 415 38.5 Plus
Dwil\GK14973-PA 1011 GK14973-PA 253..473 121..341 406 37.1 Plus
Dwil\GK14973-PA 1011 GK14973-PA 540..758 128..341 391 39.3 Plus
Dwil\GK14973-PA 1011 GK14973-PA 330..557 114..341 385 35.5 Plus
Dwil\GK14973-PA 1011 GK14973-PA 372..585 128..341 384 37.4 Plus
Dwil\GK25520-PA 589 GK25520-PA 313..536 121..345 383 34.2 Plus
Dwil\GK18485-PA 331 GK18485-PA 1..295 4..315 380 32.2 Plus
Dwil\GK14973-PA 1011 GK14973-PA 277..501 117..341 375 34.7 Plus
Dwil\GK14973-PA 1011 GK14973-PA 306..529 118..341 368 34.4 Plus
Dwil\GK14973-PA 1011 GK14973-PA 205..446 98..342 354 32.2 Plus
Dwil\GK14973-PA 1011 GK14973-PA 596..764 128..291 301 39.6 Plus
Dwil\GK10434-PA 367 GK10434-PA 19..178 184..341 251 35 Plus
Dwil\GK13252-PA 418 GK13252-PA 203..310 234..341 229 40.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 05:19:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18295-PA 346 GE18295-PA 1..346 1..346 1533 82.4 Plus
Dyak\GE18294-PA 346 GE18294-PA 1..341 1..343 1030 56.4 Plus
Dyak\GE17974-PA 438 GE17974-PA 1..395 15..340 591 34.4 Plus
Dyak\GE26193-PA 537 GE26193-PA 16..300 79..341 515 38.5 Plus
Dyak\GE26193-PA 537 GE26193-PA 254..467 126..345 478 45 Plus
Dyak\GE14934-PA 352 GE14934-PA 1..345 1..346 465 33.2 Plus
Dyak\GE17974-PA 438 GE17974-PA 232..428 121..317 389 37.6 Plus
Dyak\GE26193-PA 537 GE26193-PA 357..529 118..289 385 45.1 Plus
Dyak\GE26193-PA 537 GE26193-PA 334..525 123..313 384 41.1 Plus

LD32747.hyp Sequence

Translation from 150 to 1190

> LD32747.hyp
MAEICRVCMDISGKLVNIFDARRRTRVSIAEMIAQCTGFEVKRGDLFSEM
ICPQCYEDVKSAYGIRQTCEESHQFYCRVRDEGIEDALCALLEEEDWEIS
EDEDARIDSASAADDDGKSDSKKVAFECRECHKKYQRKGTFLRHMRTHMD
GQSFPCPYCKRNFRLRVTLKAHMKTHNAAKPYECSHCAKTFAQQSTLQSH
ERTHTGERPFKCSQCSKTFIKSSDLRRHIRTHGSERPFKCSKCTKTFTRK
FHLDNHFRSHTGERPFKCSHCPKAFAMKQHLKQHSRLHLPDRPFRCSHCP
KTFRLSSTLKEHKLVHNAERTFKCPHCASFYKQRKTLARHILEIHK*

LD32747.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:22:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG15436-PA 346 CG15436-PA 1..346 1..346 1906 100 Plus
Neu2-PA 382 CG7204-PA 1..320 15..341 527 34 Plus
CG5245-PA 501 CG5245-PA 185..435 118..341 523 38.1 Plus
CG44002-PA 345 CG44002-PA 1..338 1..292 517 33.4 Plus
Neu2-PB 308 CG7204-PB 1..276 15..312 514 36.1 Plus
Neu2-PA 382 CG7204-PA 231..376 126..263 229 31.4 Plus