Clone LD33666 Report

Search the DGRC for LD33666

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:336
Well:66
Vector:pOT2
Associated Gene/TranscriptAntp-RH
Protein status:LD33666.pep: gold
Preliminary Size:5058
Sequenced Size:4087

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1028 2001-01-01 Release 2 assignment
CG1028 2001-07-04 Blastp of sequenced clone
CG1028 2003-01-01 Sim4 clustering to Release 3
Antp 2008-04-29 Release 5.5 accounting
Antp 2008-08-15 Release 5.9 accounting
Antp 2008-12-18 5.12 accounting

Clone Sequence Records

LD33666.complete Sequence

4087 bp (4087 high quality bases) assembled on 2001-07-04

GenBank Submission: AY060407

> LD33666.complete
CCAAATAGACGTGCCGCCGCCGCTCGATTCGCACTTTGCTTTCGGTTTTG
CCGTCGTTTCACGCGTTTAGTTCCGTTCGGTTCATTCCCAGTTCTTAAAT
ACCGGACGTAAAAATACACTCTAACGGTCCCGCGAAGAAAAAGATAAAGA
CATCTCGTAGAAATATTAAAATAAATTCCTAAAGTCGTTGGTTTCTCGTT
CACTTTCGCTGCCTGCTCAGGACGAGGGCCACACCAAGAGGCAAGAGAAA
CAAAAAGAGGGAACATAGGAACAGGAACCAGATAATAGTGACATAAGCGA
CCCTTTCGCAAATATTTTGGCGCAAAATGAGCGGGCGCCAAGTGCCGCGT
GGTGGAGCCGCCTGAAAATGACATGGAAAATTCGCCGAAAATCGCGCGTT
TTGGCAGCATCAATCCCAAAGCACAAAATTAATTTCTATCATAATTTCTG
GGTGCAACACGGACCCATAATTGAATCGAATATAGGGCTTATCTGATAGC
CCGGCAGCAACATTGAACTTTCCGGCTGCAAAGGAGACGACACCGAGATC
GCCAATTTTCGTTGGGCTCGTTCTCTGGGCTCCGGCGATAAGAAATCCAT
GCTGATAAGGACAGGAGGACGGTCTGCGGCAAATTGAATTCGATTCTGAC
CTGTATGAAAGCCAGCGGAGATACGGATACCTCTGGGTTTATGGGTAGAA
AACGCAGAGCGTCGCGCCAACATCGAAATTATTTGCGTTTGCATCTTCTC
GTCCTTTCGTTTATCGTTCTGATTGCCATCGTGGTGGCGCGGTTTCTATT
AATTTTGCTTCTGTATCGTTTGCAAAATCTCAAAAGATTCAAAAAGTTCG
TCATCAGCAGCCGCAACACAAAAACCAACGAGTGTAAAGCCGAGCATACA
AATATCAATAAAAACATAAACATTTACCCAATCTCAATCTCAAAACATTC
GCATCGTTTCCACACAAATATGCTTAGTTCGCCCAAATTGTGATTGTATA
TATATATTTAACGGCATTAAATACAAAAGATTAAGCCCTAAATTAAGTGT
AAATCTTACAAAACGTCTACGTTTTTAAACAAGAAATTGTGATATTATAT
ATTAATCGGGAAATTCGAAGTATGAGAACAAAACGGTGTATATATGTAAG
TGGGCGATGAACATCAATGAATATTTTAGCTGAGCAAAGTACACACGAAT
GAATATAAATATACATGAAAATATATTTTGGGCACCGACTTTTACACCAC
AATTATATATCGATAGAAAAGACACGAAAACAATCACAGAAAACTAAGAG
TTTCAAAATCAAAATTGAGGAATACCAACTAGAGGATAAGGCTACTTAAG
GATCAAAAAACACCAAGGAGACGAGATTTTCTACCAAATCGAGAGACGAG
GGGCAGGTTAATTTCGTCATTTTTGGCCAAGACAGCAAATAGAGGAACAG
CAAAGCGAAAATCATTTTATACCTCACACAACAACTACACACTAACTAAG
ATTAGGCTACGCAACTGTACATTGTACTTAAGTGTTCAAAGTATATTTAG
TTTACTTTGTATATAAGAAAAGTAGCTAAAAGCACGCGGACAGGGAGGCA
GGAGCACCACAGTCACTAGCCACTAAGCAGAGTCACAGTCACGATCACGT
TCACTCCAGGATCAGGACTCGGGGCGGGATCAGCAGACGCTGAGGAAGCT
GCCACGATGACGATGAGTACAAACAACTGCGAGAGCATGACCTCGTACTT
CACCAACTCGTACATGGGGGCGGACATGCATCATGGGCACTACCCGGGCA
ACGGGGTCACCGACCTGGACGCCCAGCAGATGCACCACTACAGCCAGAAC
GCGAATCACCAGGGCAACATGCCCTACCCGCGCTTTCCACCCTACGACCG
CATGCCCTACTACAACGGCCAGGGGATGGACCAGCAGCAGCAGCACCAGG
TCTACTCCCGCCCGGACAGCCCCTCCAGCCAGGTGGGCGGGGTCATGCCC
CAGGCGCAGACCAACGGTCAGTTGGGTGTTCCCCAGCAGCAACAGCAGCA
GCAGCAACAGCCCTCGCAGAACCAGCAGCAACAGCAGGCGCAGCAGGCCC
CACAGCAACTGCAGCAGCAGCTGCCGCAGGTGACGCAACAGGTGACACAT
CCGCAGCAGCAACAACAGCAGCCCGTCGTCTACGCCAGCTGCAAGTTGCA
AGCGGCCGTTGGTGGACTGGGTATGGTTCCCGAGGGCGGATCGCCTCCGC
TGGTGGATCAAATGTCCGGTCACCACATGAACGCCCAGATGACGCTGCCC
CATCACATGGGACATCCGCAGGCGCAGTTGGGCTATACGGACGTTGGAGT
TCCCGACGTGACAGAGGTCCATCAGAACCATCACAACATGGGCATGTACC
AGCAGCAGTCGGGAGTTCCGCCGGTGGGTGCCCCACCTCAGGGCATGATG
CACCAGGGCCAGGGTCCTCCACAGATGCACCAGGGACATCCTGGCCAACA
CACGCCTCCTTCCCAAAACCCGAACTCGCAGTCCTCGGGGATGCCGTCTC
CACTGTATCCCTGGATGCGAAGTCAGTTTGGTAAGTGTCAAGGAAAGTGA
TCGACAATTCCACGAAACGTATTAAGTGGAATTTTTCTTCTTCTTATCGT
AGTGGGTTGAAGTAGTTAGTTCCCCGTTTAGAATTGGTCGTAGTTCCCAT
TAGAATCGTAACTGTGCATACAACAGCTAGAGCTGTATTATCTTAAATTG
TATAATACCATAACTATTACAGCGAACCTCGTGCAGCGAAGCAAAGCAGT
AAAAAGCAGTCTAGATGTACTGCTTTATATTGTGTTTCCTGCTTGATATT
AGATCACTAAGCAAGCAGACGCGCAAGCAGTTCACGCAGATCACGCAGAC
GTTAAAAATTTAAAAATGTTTTTGTTTGCAGAAAGAAGTACCCTCTTCGC
TTTTCAATTTTGTAGTTAAAATTCGAGCAAATATATTTAAATTAAAAAGG
CTCAAACTTAAAGTACTATGTATGTCTTGTATTTTTGAAAAAATTCTAAA
GTTTATTATAAAATGCATTTTAAATACATTTTTTAACCTACCTTGTCGCT
TGAAATATATAAAATTTAAGTTTTAGATATGGAATAGATAAACAAAATAT
TTCCCTCTGTCTTAACTAATTTCTTTAATTAAATGTTAAGCCCCAAAGCG
ACTACAGCTTCATGTCAAACTCTTACCTTAAATATTTAGAGTTTGTTTGC
ATTTGAACTGAGAACGTTTTGTCGACGACCTTGACACGTCCGGGTAATTT
CACTTTATTGCCTTGGCCAATTGCTTGACATCATCCGTAATCCATCTGCA
AAGACATCCCGATACCTGACATTTGTTCAAATTTGCGAATTTCCCAAATC
CGAGCAAATCGATGAATGCAGGCAGATGAAAGACGAAAGAGGTGGCGGAA
GAGGTGCTCCTTGGGTTCCGCTTGCCCAGAAGATCGCAGCACAGGAGGCG
GTCCTGCCAGCTAATGCAAATTGACAATAGCTCGAAATCGTGCAAGAAAA
AGGTTTGCCAAAACCCTAGGCGTAACTAATGAGGGCTGGAAAATAGAGCA
CACTGACTGCATGTGGTACTGCTTTAGGCTTAGAGGATGTTGCATAAGTG
GGGATAGGGCTCGGCCGCCTTTCGAGCGAAAAAGGTGTAAGGTCTAGGAG
GCGAGTCCTTTTCAAATATAGAATTCCAATGGCATGTCACTTTCCTCGGA
GAAAGTGAAAGTAGGCCTCAAGTGGTCGGTGCCTTTGCCTTGCCCTCCAG
CTGACCTGCTCCCTGGTCATTACGCAGTCCAAGGAGCTCTAGCTCTCCCC
ATACCCAGCTCTCAATGTTGTTGTGGTTTTTTGTTTGTAGCCGGCTGAAT
TTTTTCGCCAAAGCCAGATTGAGATGTAAAGCACAATTGATGAGCGCCAT
TAGTTACACGTTATGTGCAATGGATGCCATCAATTTATTAATCTCCAGAA
CACGCCGAGGCTCCATTCATAGCACCACTTCGTCGTCTTAATCCCCTCCC
TCATCCGCCATGGCGGTGCAAAAAAAAAAAAAAAAAA

LD33666.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:30:32
Subject Length Description Subject Range Query Range Score Percent Strand
Antp-RH 4111 Antp-RH 25..4105 1..4081 20390 99.9 Plus
Antp.d 3490 Antp.d 25..2616 1..2592 12960 100 Plus
Antp-RD 4890 Antp-RD 25..2604 1..2580 12900 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:12:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2732898..2734616 4069..2365 8350 99.2 Minus
chr3R 27901430 chr3R 2757406..2758703 1298..1 6445 99.8 Minus
chr3R 27901430 chr3R 2735166..2735944 2327..1549 3895 100 Minus
chr3R 27901430 chr3R 2736096..2736349 1550..1297 1270 100 Minus
chr3R 27901430 chr3R 2734747..2734791 2368..2324 225 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:12:02
Subject Length Description Subject Range Query Range Score Percent Strand
Antp-RH 894 CG1028-PH 1..894 1707..2600 4470 100 Plus
Antp-RJ 1137 CG1028-PJ 1..886 1707..2592 4430 100 Plus
Antp-RI 1137 CG1028-PI 1..886 1707..2592 4430 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:27:49 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:12:00
Subject Length Description Subject Range Query Range Score Percent Strand
Antp-RH 4111 CG1028-RH 25..4093 1..4069 20345 100 Plus
Antp-RJ 3490 CG1028-RJ 25..2616 1..2592 12960 100 Plus
Antp-RL 4902 CG1028-RL 25..2616 1..2592 12960 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:12:05
Subject Length Description Subject Range Query Range Score Percent Strand
Antp-PH 297 CG1028-PH 1..297 1707..2597 1001 100 Plus
Antp-PJ 378 CG1028-PJ 1..295 1707..2591 990 100 Plus
Antp-PI 378 CG1028-PI 1..295 1707..2591 990 100 Plus
Antp-PL 378 CG1028-PL 1..295 1707..2591 990 100 Plus
Antp-PN 374 CG1028-PN 1..297 1707..2597 971 98.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:11:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6907024..6908740 4081..2365 8570 99.9 Minus
3R 32079331 3R 6931519..6932816 1298..1 6490 100 Minus
3R 32079331 3R 6909290..6910068 2327..1549 3895 100 Minus
3R 32079331 3R 6910220..6910473 1550..1297 1270 100 Minus
3R 32079331 3R 6908871..6908915 2368..2324 225 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:52:47
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6647855..6649571 4081..2365 8570 99.9 Minus
3R 31820162 3R 6672350..6673647 1298..1 6490 100 Minus
3R 31820162 3R 6650121..6650899 2327..1549 3895 100 Minus
3R 31820162 3R 6651051..6651304 1550..1297 1270 100 Minus
3R 31820162 3R 6649702..6649746 2368..2324 225 100 Minus
Blast to na_te.dros performed 2014-11-27 15:11:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6721..6851 2033..2172 337 75 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6764..6900 2034..2170 316 72.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6800..6923 2034..2169 275 71.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2343..2497 2034..2193 266 65 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2397..2536 2034..2173 259 65 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6728..7004 1910..2172 251 60.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2310..2415 2067..2172 242 69.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6859 2056..2194 238 64.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2406 2073..2172 203 67 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2726..2890 2031..2196 196 60.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2517..2655 2034..2172 191 61.7 Plus
roo 9092 roo DM_ROO 9092bp 1059..1154 2071..2169 191 67.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2306..2403 2078..2172 186 67.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2324..2826 1653..2172 182 53.9 Plus
gypsy10 6006 gypsy10 GYPSY10 6006bp 619..832 2940..3147 182 58.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6803 2071..2172 174 70.6 Plus
roo 9092 roo DM_ROO 9092bp 1060..1133 2099..2172 163 68.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6661..6804 2054..2193 161 59 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2376 2103..2172 134 65.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1470..1578 2067..2172 123 60.9 Plus

LD33666.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:07:29 Download gff for LD33666.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2757406..2758703 1..1298 99   Minus
chr3R 2736096..2736347 1299..1550 100 <- Minus
chr3R 2735460..2735942 1551..2033 100 <- Minus
chr3R 2735166..2735363 2130..2327 100 == Minus
chr3R 2734749..2734787 2328..2366 100 <- Minus
chr3R 2732954..2734614 2367..4027 100 <- Minus
chr3R 2732898..2732938 4028..4069 97 -> Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:19:13 Download gff for LD33666.complete
Subject Subject Range Query Range Percent Splice Strand
Antp-RH 1..894 1707..2600 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:18:47 Download gff for LD33666.complete
Subject Subject Range Query Range Percent Splice Strand
Antp-RH 1..894 1707..2600 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:24:24 Download gff for LD33666.complete
Subject Subject Range Query Range Percent Splice Strand
Antp-RH 1..894 1707..2600 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:50:23 Download gff for LD33666.complete
Subject Subject Range Query Range Percent Splice Strand
Antp-RH 1..894 1707..2600 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:07:29 Download gff for LD33666.complete
Subject Subject Range Query Range Percent Splice Strand
Antp-RH 1..894 1707..2600 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:19:13 Download gff for LD33666.complete
Subject Subject Range Query Range Percent Splice Strand
Antp-RH 25..4093 1..4069 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:18:47 Download gff for LD33666.complete
Subject Subject Range Query Range Percent Splice Strand
Antp-RH 25..4093 1..4069 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:24:24 Download gff for LD33666.complete
Subject Subject Range Query Range Percent Splice Strand
Antp-RH 25..4093 1..4069 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:50:23 Download gff for LD33666.complete
Subject Subject Range Query Range Percent Splice Strand
Antp-RH 25..4093 1..4069 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:07:29 Download gff for LD33666.complete
Subject Subject Range Query Range Percent Splice Strand
Antp-RH 25..4093 1..4069 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:07:29 Download gff for LD33666.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6931519..6932816 1..1298 100   Minus
3R 6910220..6910471 1299..1550 100 <- Minus
3R 6909290..6910066 1551..2327 100 <- Minus
3R 6908873..6908911 2328..2366 100 <- Minus
3R 6907036..6908738 2367..4069 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:24:24 Download gff for LD33666.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2757241..2758538 1..1298 100   Minus
arm_3R 2735942..2736193 1299..1550 100 <- Minus
arm_3R 2735012..2735788 1551..2327 100 <- Minus
arm_3R 2734595..2734633 2328..2366 100 <- Minus
arm_3R 2732758..2734460 2367..4069 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:28:40 Download gff for LD33666.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6672350..6673647 1..1298 100   Minus
3R 6651051..6651302 1299..1550 100 <- Minus
3R 6650121..6650897 1551..2327 100 <- Minus
3R 6649704..6649742 2328..2366 100 <- Minus
3R 6647867..6649569 2367..4069 100 <- Minus

LD33666.pep Sequence

Translation from 1706 to 2599

> LD33666.pep
MTMSTNNCESMTSYFTNSYMGADMHHGHYPGNGVTDLDAQQMHHYSQNAN
HQGNMPYPRFPPYDRMPYYNGQGMDQQQQHQVYSRPDSPSSQVGGVMPQA
QTNGQLGVPQQQQQQQQQPSQNQQQQQAQQAPQQLQQQLPQVTQQVTHPQ
QQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH
MGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQ
GQGPPQMHQGHPGQHTPPSQNPNSQSSGMPSPLYPWMRSQFGKCQGK*

LD33666.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 05:10:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17789-PA 378 GF17789-PA 1..301 1..297 1130 84.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 05:10:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\Antp-PA 374 GG10169-PA 1..297 1..297 1152 88.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 05:10:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19475-PA 385 GH19475-PA 1..308 1..297 935 79.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 05:10:44
Subject Length Description Subject Range Query Range Score Percent Strand
Antp-PH 297 CG1028-PH 1..297 1..297 1655 100 Plus
Antp-PJ 378 CG1028-PJ 1..295 1..295 1644 100 Plus
Antp-PI 378 CG1028-PI 1..295 1..295 1644 100 Plus
Antp-PL 378 CG1028-PL 1..295 1..295 1644 100 Plus
Antp-PM 378 CG1028-PM 1..295 1..295 1644 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 05:11:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24713-PA 378 GI24713-PA 1..301 1..297 970 82.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 05:11:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22036-PA 395 GL22036-PA 1..318 1..297 1058 81.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 05:11:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Antp-PB 315 GA10215-PB 1..315 1..297 1066 84.8 Plus
Dpse\Antp-PA 392 GA10215-PA 1..315 1..297 1061 83.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 05:11:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10522-PA 374 GM10522-PA 1..297 1..297 1474 98.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 05:11:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19515-PA 374 GD19515-PA 1..297 1..297 1474 98.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 05:11:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Antp-PA 376 GJ23927-PA 1..299 1..297 1004 85 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 05:11:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10824-PA 374 GK10824-PA 1..297 1..297 1052 86.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 05:11:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25826-PA 375 GE25826-PA 1..298 1..297 1162 97.3 Plus

LD33666.hyp Sequence

Translation from 1706 to 2599

> LD33666.hyp
MTMSTNNCESMTSYFTNSYMGADMHHGHYPGNGVTDLDAQQMHHYSQNAN
HQGNMPYPRFPPYDRMPYYNGQGMDQQQQHQVYSRPDSPSSQVGGVMPQA
QTNGQLGVPQQQQQQQQQPSQNQQQQQAQQAPQQLQQQLPQVTQQVTHPQ
QQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH
MGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQ
GQGPPQMHQGHPGQHTPPSQNPNSQSSGMPSPLYPWMRSQFGKCQGK*

LD33666.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:05:29
Subject Length Description Subject Range Query Range Score Percent Strand
Antp-PH 297 CG1028-PH 1..297 1..297 1655 100 Plus
Antp-PJ 378 CG1028-PJ 1..295 1..295 1644 100 Plus
Antp-PI 378 CG1028-PI 1..295 1..295 1644 100 Plus
Antp-PL 378 CG1028-PL 1..295 1..295 1644 100 Plus
Antp-PM 378 CG1028-PM 1..295 1..295 1644 100 Plus