Clone LD33841 Report

Search the DGRC for LD33841

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:338
Well:41
Vector:pOT2
Associated Gene/Transcriptdlg1-RC
Protein status:LD33841.pep: gold
Preliminary Size:2867
Sequenced Size:2639

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1730 2001-01-01 Release 2 assignment
CG1725 2002-01-03 Blastp of sequenced clone
CG1725 2003-01-01 Sim4 clustering to Release 3
dlg1 2008-04-29 Release 5.5 accounting
dlg1 2008-08-15 Release 5.9 accounting
dlg1 2008-12-18 5.12 accounting

Clone Sequence Records

LD33841.complete Sequence

2639 bp (2639 high quality bases) assembled on 2002-01-03

GenBank Submission: AY075410

> LD33841.complete
CTAGAACTAGTGTTCCCGTGAGCAGAGCAGAAAACCGTAATATATATTCT
CCAACGTGCTGCCGCTACTTATTTATATTAAACATAAAATGCCCGAAGGC
TGTGCCAAACGCATGTCCTTTTTGCCAATGGTGAATGCAATATAGAATCA
AATCAAGTGAACGCGAAGTAAGCAAATAAACGATCTGAGTTTTTTTTTGT
GTTGGTGTTGTTGTGTTGTGACGAGGAAAGTACGACATTTCGATGATAGT
CGCATTGCAATATAAAGTGCAACATAAATGCTATAGAACCGAATGTGAAT
GTGAGGAGCCATTGAGCTGTGAAATGTGAAAATCGCAAAGAAATCGAGAG
AAAACGCACACGTCAATGTAACCACAAAGCTGCCCCAAGAAAACGAAAAG
TAAAATATATAAAGAAATTAAAAAATAAACTAGCAAACTGAAAGCGCAAA
ATTAAAAAAAAAACAACAAATCTCGAACTTTGTTCGAAAGCCAAAGTATC
TAACAAAACAATATTTGTACATAAAACACCATCGAATAGTATATATATAT
ATATACATATATATCAGATATATATACAGATGTGCTGGCGAAACTAAAAG
GAGGAGAACTCAAGGAAAAGCCAAAGCGATTTTTCCGCACATTTCCACTC
GAAAGCGACTCCAGTAAATTCTCAAAATTGCGACCCACGCTTTTCCCAGT
TCGGCGGCGTTGAACCACAATCAAAGCTGCTGCACCACCGCCATTTCCGC
TGCCATTTCCACCAGCACCACCATAAATAGTAGCAGAAACACCGCTCACA
GAATGCCAGTGAAAAAGCAAGAAGCTCATCGGGCTCTCGAGCTGCTCGAG
GACTACCACGCGAGACTTTCGGAGCCGCAGGATCGGGCGCTGCGTATTGC
AATCGAACGCGTTATACGCATATTTAAATCTCGCTTGTTTCAAGCGCTGT
TAGATATACAAGAATTCTATGAATTGACATTATTGGATGACTCGAAGAGC
ATACAACAAAAGACAGCGGAGACCTTGCAAATTGCAACCAAATGGGAAAA
GGATGGCCAGGCAGTCAAAATAGCTGATAATCAGCGCATGCGCATCGAAT
CGGACACGGAAAATGCCAAGGAGCCAACTGTCGAGCAGCAGCAAAAGCAG
CAGCAAGCGCAGCAGCGCAGTTCCCGCTCCCCGCAGCAGCAGAATCCGCA
GCAGCAGCAGGGATCCAAATCGAGGAGCGGGTCCCAGACTTCACAGATAC
AGATACAGTCACTTACACAGACATACCCAAACGCACACCAGCGCAAGCGA
GTCCTCGTGAGCCTCCATCCACATCAACATCAACATCAAAGCCAAATTCA
ACACCAACACCATTACCAACTTCGCCATAACAACGGCATTCAAGCCAAAA
TGCTTAAGCGCGCTTTTGAGTCCACCTAGTTTTACCCCGCCATTTTCCCG
GCGTGGAAAAGTCCTCGAGGGCAGAGCAATCAGCTCGCGGAAAAGCCAAG
GAGGTGGAAAACAGCTGGCTGTGTAATTAGCCCCCCCCCCCCTCTGCTCA
AAGAATTCATTAGTTCGCAATTTCGAGGCTGCTCCCATTTGCACTTCATT
TCGGGTCTTCACAAAAGAATCAAACAAATTAATTAATTTTTCGGAGGCTT
TGATTAAATTGCTCAACATTTAACTCATTTAACGCATAAGGTTGAAAATA
TCGTTGTTGCTACATTTTGTGATTAATTAAAAAACGATGCAACCATAGTT
TATCGCTAAGTTAAGCTAAATTCAAACCGTCTTATTCATATTGTTTAATA
TATGAGGCGACCAAAATGAGGACAAAGATACCCACCTTCCACTAACATTC
CGTATGATAAATACATTGCTCTAGTTTTTTGCCAGGAATCGAGTCAAAGA
CCGGATTTAGTGCCATATTCAGACAACAGATGGAATTTGAATTCGATTTT
TTAAGTTGCATGTTACACTGCAACCGCATTTTCAGCTTAATTATTCATGT
GGCACGGAACGTGGGCGGTAACGCCCACAATTTTAAATCGCCATTGGTGA
GGCCAGTGTAATTGGGAGCACGCCAGTGTATTTATCCGCCTTTTTGCCCA
TTTTCCTGGCTTTTTAACGAATCGTTACTTACTTAAGACGCTTAAGGCGC
TCGGCCTTCTCGCTTTTGTGGGCCAAGCGTCGCCCATTTCCGTTTCCGGT
GCGCTGTTGTTGTTGCTCGTTGTAGCTAAACTGGCCAGAAGGAGAAAGTA
CATATAGCAACGAGAACGGGAAAACTGCCAACGGGCGTAACACATTTTCT
TTATATTAAAGCTAACGATATTTATACTAAGTTTTTAGTGCACGATTTTG
TTTGATTAGTGCTTACTAGCGAATAAGGTACATTGTGAAAGACATTAAAT
CAAGCTTATTTATAATTTTAGCTTAAGTTTGGTGCATGTTTTGGTTATTA
ATAATGTTTTAAGTTGCCAAATTAAATTTGATTTTGATTTAAGAAACATA
CCATGTGAACCCCATTTAAAAAATATACATACATTTTGCGCTTCTTAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

LD33841.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:34:05
Subject Length Description Subject Range Query Range Score Percent Strand
dlg1-RC 2582 dlg1-RC 37..2582 1..2546 12730 100 Plus
dlg1.g 2491 dlg1.g 73..2491 128..2546 12095 100 Plus
dlg1-RO 2335 dlg1-RO 363..2335 568..2546 9780 99.6 Plus
dlg1-RO 2335 dlg1-RO 91..362 128..399 1360 100 Plus
dlg1.g 2491 dlg1.g 37..72 1..36 180 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:08:35
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11279142..11280446 1241..2546 6450 99.8 Plus
chrX 22417052 chrX 11264976..11265669 128..821 3425 99.6 Plus
chrX 22417052 chrX 11278928..11279089 1079..1240 810 100 Plus
chrX 22417052 chrX 11267999..11268132 820..953 670 100 Plus
chrX 22417052 chrX 11260833..11260959 1..127 635 100 Plus
chrX 22417052 chrX 11273016..11273142 952..1078 620 99.2 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:08:31
Subject Length Description Subject Range Query Range Score Percent Strand
dlg1-RI 627 CG1725-PI 1..627 803..1429 3135 100 Plus
dlg1-RJ 627 CG1725-PJ 1..627 803..1429 3135 100 Plus
dlg1-RC 627 CG1725-PC 1..627 803..1429 3135 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:28:08 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:08:29
Subject Length Description Subject Range Query Range Score Percent Strand
dlg1-RC 2554 CG1725-RC 9..2554 1..2546 12730 100 Plus
dlg1-RI 2114 CG1725-RI 136..2114 568..2546 9895 100 Plus
dlg1-RJ 2102 CG1725-RJ 136..2102 580..2546 9835 100 Plus
dlg1-RI 2114 CG1725-RI 9..137 1..129 645 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:08:33
Subject Length Description Subject Range Query Range Score Percent Strand
dlg1-PI 208 CG1725-PI 1..208 803..1426 654 100 Plus
dlg1-PJ 208 CG1725-PJ 1..208 803..1426 654 100 Plus
dlg1-PC 208 CG1725-PC 1..208 803..1426 654 100 Plus
dlg1-PU 198 CG1725-PU 1..198 803..1426 643 79.8 Plus
dlg1-PO 206 CG1725-PO 1..206 803..1426 643 87.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:08:27
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11387986..11389292 1241..2547 6535 100 Plus
X 23542271 X 11373817..11374510 128..821 3470 100 Plus
X 23542271 X 11387772..11387933 1079..1240 810 100 Plus
X 23542271 X 11376840..11376973 820..953 670 100 Plus
X 23542271 X 11369673..11369799 1..127 635 100 Plus
X 23542271 X 11381854..11381980 952..1078 635 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:02:03
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11396084..11397390 1241..2547 6535 100 Plus
X 23527363 X 11381915..11382608 128..821 3470 100 Plus
X 23527363 X 11395870..11396031 1079..1240 810 100 Plus
X 23527363 X 11384938..11385071 820..953 670 100 Plus
X 23527363 X 11389952..11390078 952..1078 635 100 Plus
X 23527363 X 11377771..11377897 1..127 635 100 Plus
Blast to na_te.dros performed 2014-11-27 03:08:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2285..2538 1114..1370 222 57.7 Plus
rover 7318 rover ROVER 7318bp 1930..1997 1331..1398 123 68.1 Plus

LD33841.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 04:29:27 Download gff for LD33841.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11279142..11280446 1241..2546 99   Plus
chrX 11278928..11279089 1079..1240 100 -> Plus
chrX 11273018..11273142 954..1078 99 -> Plus
chrX 11268001..11268132 822..953 100 -> Plus
chrX 11264976..11265669 128..821 99 -> Plus
chrX 11260833..11260959 1..127 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:42:41 Download gff for LD33841.complete
Subject Subject Range Query Range Percent Splice Strand
dlg1-RI 1..627 803..1429 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:56:17 Download gff for LD33841.complete
Subject Subject Range Query Range Percent Splice Strand
dlg1-RI 1..627 803..1429 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:04:35 Download gff for LD33841.complete
Subject Subject Range Query Range Percent Splice Strand
dlg1-RC 1..627 803..1429 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:21:07 Download gff for LD33841.complete
Subject Subject Range Query Range Percent Splice Strand
dlg1-RI 1..627 803..1429 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:29:27 Download gff for LD33841.complete
Subject Subject Range Query Range Percent Splice Strand
dlg1-RC 1..627 803..1429 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:42:40 Download gff for LD33841.complete
Subject Subject Range Query Range Percent Splice Strand
dlg1-RC 37..2582 1..2546 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:56:17 Download gff for LD33841.complete
Subject Subject Range Query Range Percent Splice Strand
dlg1-RC 37..2582 1..2546 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:04:35 Download gff for LD33841.complete
Subject Subject Range Query Range Percent Splice Strand
dlg1-RC 9..2554 1..2546 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:21:07 Download gff for LD33841.complete
Subject Subject Range Query Range Percent Splice Strand
dlg1-RC 37..2582 1..2546 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:29:27 Download gff for LD33841.complete
Subject Subject Range Query Range Percent Splice Strand
dlg1-RC 9..2554 1..2546 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 04:29:27 Download gff for LD33841.complete
Subject Subject Range Query Range Percent Splice Strand
X 11387986..11389291 1241..2546 100   Plus
X 11387772..11387933 1079..1240 100 -> Plus
X 11381856..11381980 954..1078 100 -> Plus
X 11376842..11376973 822..953 100 -> Plus
X 11373817..11374510 128..821 100 -> Plus
X 11369673..11369799 1..127 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:04:35 Download gff for LD33841.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11282019..11283324 1241..2546 100   Plus
arm_X 11281805..11281966 1079..1240 100 -> Plus
arm_X 11275889..11276013 954..1078 100 -> Plus
arm_X 11270875..11271006 822..953 100 -> Plus
arm_X 11267850..11268543 128..821 100 -> Plus
arm_X 11263706..11263832 1..127 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:55:49 Download gff for LD33841.complete
Subject Subject Range Query Range Percent Splice Strand
X 11396084..11397389 1241..2546 100   Plus
X 11395870..11396031 1079..1240 100 -> Plus
X 11389954..11390078 954..1078 100 -> Plus
X 11384940..11385071 822..953 100 -> Plus
X 11381915..11382608 128..821 100 -> Plus
X 11377771..11377897 1..127 100 -> Plus

LD33841.pep Sequence

Translation from 802 to 1428

> LD33841.pep
MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
DTENAKEPTVEQQQKQQQAQQRSSRSPQQQNPQQQQGSKSRSGSQTSQIQ
IQSLTQTYPNAHQRKRVLVSLHPHQHQHQSQIQHQHHYQLRHNNGIQAKM
LKRAFEST*

LD33841.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 23:20:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19076-PA 567 GF19076-PA 344..430 6..92 454 98.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 23:20:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18413-PA 567 GG18413-PA 301..387 6..92 454 98.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 23:20:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12184-PA 216 GH12184-PA 1..178 1..127 507 61.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:19:59
Subject Length Description Subject Range Query Range Score Percent Strand
dlg1-PI 208 CG1725-PI 1..208 1..208 1055 100 Plus
dlg1-PJ 208 CG1725-PJ 1..208 1..208 1055 100 Plus
dlg1-PC 208 CG1725-PC 1..208 1..208 1055 100 Plus
dlg1-PO 206 CG1725-PO 1..206 1..208 1033 99 Plus
dlg1-PU 198 CG1725-PU 1..198 1..208 989 95.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 23:20:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15715-PA 497 GI15715-PA 288..379 1..92 453 94.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 23:20:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14854-PA 213 GL14854-PA 1..213 1..208 612 66.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 23:20:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14413-PA 578 GA14413-PA 308..394 6..92 453 98.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 23:20:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11477-PA 403 GM11477-PA 302..392 6..96 455 95.6 Plus
Dsec\GM13074-PA 178 GM13074-PA 60..178 93..208 329 90 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 23:20:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17020-PA 298 GD17020-PA 1..262 1..205 540 63.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 23:20:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15243-PA 206 GJ15243-PA 1..92 1..92 481 98.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 23:20:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16228-PA 265 GK16228-PA 1..92 1..92 482 96.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 23:20:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15930-PA 274 GE15930-PA 1..92 1..92 493 100 Plus

LD33841.hyp Sequence

Translation from 802 to 1428

> LD33841.hyp
MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
DTENAKEPTVEQQQKQQQAQQRSSRSPQQQNPQQQQGSKSRSGSQTSQIQ
IQSLTQTYPNAHQRKRVLVSLHPHQHQHQSQIQHQHHYQLRHNNGIQAKM
LKRAFEST*

LD33841.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:03:01
Subject Length Description Subject Range Query Range Score Percent Strand
dlg1-PI 208 CG1725-PI 1..208 1..208 1055 100 Plus
dlg1-PJ 208 CG1725-PJ 1..208 1..208 1055 100 Plus
dlg1-PC 208 CG1725-PC 1..208 1..208 1055 100 Plus
dlg1-PO 206 CG1725-PO 1..206 1..208 1033 99 Plus
dlg1-PU 198 CG1725-PU 1..198 1..208 989 95.2 Plus