Clone LD34211 Report

Search the DGRC for LD34211

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:342
Well:11
Vector:pOT2
Associated Gene/TranscriptYkt6-RA
Protein status:LD34211.pep: gold
Preliminary Size:1660
Sequenced Size:1439

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1515 2001-01-01 Release 2 assignment
CG1515 2001-07-04 Blastp of sequenced clone
CG1515 2003-01-01 Sim4 clustering to Release 3
l(1)G0155 2008-04-29 Release 5.5 accounting
l(1)G0155 2008-08-15 Release 5.9 accounting
l(1)G0155 2008-12-18 5.12 accounting

Clone Sequence Records

LD34211.complete Sequence

1439 bp (1439 high quality bases) assembled on 2001-07-04

GenBank Submission: AY059454

> LD34211.complete
GGGAACGGCACAGATTTACTGCGTTAAACAAACTCACTTGTCGCACTTTT
CCACGAATGCCAGTGCGCTGAAAGTGAAACCCATCCGCCGGAGCATAGTA
GGATTAGCCAGGACAACCGTTCAGCTCAGTGCCCCAGAAGCATTTAATTG
GAGGAGCAACAGTCGAGCAACCCGCGACCCGCAGACCCAGTCTTGGCAGC
CCACAGCCACTCAAAATGGTCAAACTATTCGCGTTGAGCATCTTTCACAA
GGGCGCCAGCGAGGCGCGTCTCCTGAAGACCGCCTCGGACCTGCAGTCCT
TCTCCTTTTTCCAACGTGGCACCGTCAACGAGTTCATGACTTTCGCTTCG
AAGACGATTGTGGAGCGCACACAGCCGGCCCTGCGGCAATCGGTGAAACA
GGATGCCTACATGTGTCATGTCTATGTGCGGGCGGACAATCTGGCCGGTG
TACTGATCGCCGATCATGAGTATCCGCATCGCGTGGCGCACACGCTTATC
ACAAAGATTCTGGATGACTTTACGGCCAAGGTGTCGGCCGATCAGTGGCC
CAATGGCACGGAGGCCACTATCTCATTTGACTTGCTGCCAGCGTTTCTAG
CACGCTATCAAAATCCCGTCGAAGCAGATCCGCTGACGAAAATGCAAAAC
GACCTGGACGAAACGAAGATCATACTGAAGAATACCATCGAGGCGGTGCT
GGAGCGGGGCGAGAAGCTGGACGACATGGTCAGCAAGTCGGAGAAATTGT
CGCTGCAGAGCAAGGCGTTCTACAAGACGGCGAAAAAGACTAACTCCTGC
TGCAGCTTCACCTAGACGACAGCTGCACCTCTCATCACCCCCCACCACAC
GCTAATCCTCTCAAGCAACAACCACAACAGGAAACACCAGAAAATGCAAA
TCAAAGACAACACAAAGGATAATGGATAACACGATAACACCAACAAACTA
CAACCAAACAAACTCCAAGGGAGCGGTGCGACTTGGGCTTTGATGATTGC
TTTTTATAAATGAATTAGTTAATTTTATATACTATATATATATATTATAT
TATATACTGTATGAATAGGATGGCCAGTTGCCAGTTACGATAGTCCGCTA
ACCCAATGTCTACCTGTCTGTATATGTCTACGCTTTGGATATCTAAATGT
TAATTACTACCAATACAGATTACGATCTAAACCCATGTGCTTAACATAAT
CTTCTCTTCACTTATGTGTTGGCACGGCGGTCCAAAATTGGCCCTTTGCT
AGCTATTGATGTTGTGGGCCTTCTTATCGCCTCCACGGCGGATCTATGTA
TACCAATCGGATCGGAAGGCTGCACCTATGTATACACATGCAGTCGCACT
TCCGATCCGGGCAACTGGCGGTCGGAATGTGTGGGCGTTTCAATAAAGAA
GTATTATGGGAAATGTGAAAAAAAAAAAAAAAAAAAAAA

LD34211.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:30:31
Subject Length Description Subject Range Query Range Score Percent Strand
Ykt6-RA 1594 Ykt6-RA 151..1569 1..1419 7095 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:39:14
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 7812803..7813543 341..1081 3705 100 Plus
chrX 22417052 chrX 7812374..7812713 1..340 1700 100 Plus
chrX 22417052 chrX 7813543..7813846 1114..1417 1505 99.7 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:39:10
Subject Length Description Subject Range Query Range Score Percent Strand
Ykt6-RA 600 CG1515-PA 1..600 216..815 3000 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:28:33 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:39:09
Subject Length Description Subject Range Query Range Score Percent Strand
Ykt6-RA 1469 CG1515-RA 53..1469 1..1417 7085 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:39:13
Subject Length Description Subject Range Query Range Score Percent Strand
Ykt6-PA 199 CG1515-PA 1..199 216..812 1011 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:39:07
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7920890..7921968 341..1419 5395 100 Plus
X 23542271 X 7920461..7920800 1..340 1700 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:52:46
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 7928988..7930066 341..1419 5395 100 Plus
X 23527363 X 7928559..7928898 1..340 1700 100 Plus
Blast to na_te.dros performed on 2014-11-26 19:39:08 has no hits.

LD34211.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:25:30 Download gff for LD34211.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 7813547..7813846 1118..1417 99   Plus
chrX 7813519..7813546 1057..1085 93 == Plus
chrX 7812803..7813462 341..1000 100 == Plus
chrX 7812374..7812713 1..340 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:16:09 Download gff for LD34211.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0155-RA 1..600 216..815 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:18:46 Download gff for LD34211.complete
Subject Subject Range Query Range Percent Splice Strand
Ykt6-RA 1..600 216..815 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:51:23 Download gff for LD34211.complete
Subject Subject Range Query Range Percent Splice Strand
Ykt6-RA 1..600 216..815 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:50:22 Download gff for LD34211.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0155-RA 1..600 216..815 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:25:30 Download gff for LD34211.complete
Subject Subject Range Query Range Percent Splice Strand
Ykt6-RA 1..600 216..815 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:14:12 Download gff for LD34211.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0155-RA 1..1417 1..1417 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:18:46 Download gff for LD34211.complete
Subject Subject Range Query Range Percent Splice Strand
Ykt6-RA 1..1417 1..1417 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:51:23 Download gff for LD34211.complete
Subject Subject Range Query Range Percent Splice Strand
Ykt6-RA 53..1469 1..1417 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:50:22 Download gff for LD34211.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0155-RA 1..1417 1..1417 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:25:30 Download gff for LD34211.complete
Subject Subject Range Query Range Percent Splice Strand
Ykt6-RA 53..1469 1..1417 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:25:30 Download gff for LD34211.complete
Subject Subject Range Query Range Percent Splice Strand
X 7920890..7921966 341..1417 100   Plus
X 7920461..7920800 1..340 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:51:23 Download gff for LD34211.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7814923..7815999 341..1417 100   Plus
arm_X 7814494..7814833 1..340 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:28:39 Download gff for LD34211.complete
Subject Subject Range Query Range Percent Splice Strand
X 7928988..7930064 341..1417 100   Plus
X 7928559..7928898 1..340 100 -> Plus

LD34211.pep Sequence

Translation from 215 to 814

> LD34211.pep
MVKLFALSIFHKGASEARLLKTASDLQSFSFFQRGTVNEFMTFASKTIVE
RTQPALRQSVKQDAYMCHVYVRADNLAGVLIADHEYPHRVAHTLITKILD
DFTAKVSADQWPNGTEATISFDLLPAFLARYQNPVEADPLTKMQNDLDET
KIILKNTIEAVLERGEKLDDMVSKSEKLSLQSKAFYKTAKKTNSCCSFT*

LD34211.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 14:20:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21192-PA 199 GF21192-PA 1..199 1..199 995 93 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 14:20:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19670-PA 199 GG19670-PA 1..199 1..199 1065 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 14:20:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12325-PA 199 GH12325-PA 1..198 1..198 965 89.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 14:20:44
Subject Length Description Subject Range Query Range Score Percent Strand
Ykt6-PA 199 CG1515-PA 1..199 1..199 1011 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 14:20:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14604-PA 199 GI14604-PA 1..199 1..199 971 88.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 14:20:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18342-PA 199 GL18342-PA 1..199 1..199 1023 95 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 14:20:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13531-PA 199 GA13531-PA 1..199 1..199 1023 95 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 14:20:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11984-PA 199 GM11984-PA 1..199 1..199 1065 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 14:20:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16871-PA 199 GD16871-PA 1..199 1..199 1065 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 14:20:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19012-PA 199 GJ19012-PA 1..198 1..198 984 90.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 14:20:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25383-PA 199 GK25383-PA 1..199 1..199 946 87.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 14:20:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15747-PA 199 GE15747-PA 1..199 1..199 1065 100 Plus

LD34211.hyp Sequence

Translation from 215 to 814

> LD34211.hyp
MVKLFALSIFHKGASEARLLKTASDLQSFSFFQRGTVNEFMTFASKTIVE
RTQPALRQSVKQDAYMCHVYVRADNLAGVLIADHEYPHRVAHTLITKILD
DFTAKVSADQWPNGTEATISFDLLPAFLARYQNPVEADPLTKMQNDLDET
KIILKNTIEAVLERGEKLDDMVSKSEKLSLQSKAFYKTAKKTNSCCSFT*

LD34211.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:03:02
Subject Length Description Subject Range Query Range Score Percent Strand
Ykt6-PA 199 CG1515-PA 1..199 1..199 1011 100 Plus