Clone LD34766 Report

Search the DGRC for LD34766

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:347
Well:66
Vector:pOT2
Associated Gene/TranscriptTfIIS-RA
Protein status:LD34766.pep: gold
Preliminary Size:1758
Sequenced Size:1708

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3710 2001-01-01 Release 2 assignment
CG3710 2001-07-04 Blastp of sequenced clone
CG3710 2003-01-01 Sim4 clustering to Release 3
TfIIS 2008-04-29 Release 5.5 accounting
TfIIS 2008-08-15 Release 5.9 accounting
TfIIS 2008-12-18 5.12 accounting

Clone Sequence Records

LD34766.complete Sequence

1708 bp (1708 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051843

> LD34766.complete
TCAACTCGTTCTGCGAATACAGAAACGAAAAAAATAGTAAACAACATTTA
TTGGAGGGAAAAAAAGAAATAGCCCGGCTTCCGCATAAACAACTGTCGCA
GACCCGCAGCACCGATTAAAGCCGACAGCCGACGCCAGTTAACCTAACCT
CTGATCAAATTAAGTGGGCCAAAATGAGCGTGGAGGAGGAAGTGTTTCGA
ATCCAAAAGAAGATGAGCAAGATGGCCAGCGACGGCACAGGACAGGATCA
GGCTCTGGACCTGCTGAAGGCCCTGCAAACGCTTAACATCAATCTCGACA
TTCTGACCAAAACGCGCATCGGCATGACCGTAAACGAGCTGCGCAAGAGT
AGCAAGGACGACGAGGTGATCGCTCTGGCCAAGACGCTGATCAAGAACTG
GAAACGATTCCTCGCCAGCCCGGCGCCAACCACACCGAACAACAGCTCCG
CTAAGGAGGGCTCCTCCAACAACAGCAGTGCCTCGAAGTCCACCAGTGCC
GCCAAGTCGTCGTCGTCAATCTCCGGCAAGGATAAGTCCAGTTCATCCAG
CTCATCCAAGGATAAAGAGAAGAAAGGCTCGACATCCTCGTCACAGACCT
CGTTTCCCTCCGGCGGCATGACAGATGCGGTCCGCATCAAATGCCGCGAA
ATGCTGGCCACCGCACTGAAGATTGGTGAAGTGCCCGAAGGATGCGGTGA
GCCGGAGGAAATGGCCGCCGAACTGGAGGATGCCATTTACTCCGAGTTCA
ATAACACGGATATGAAGTACAAGAATCGCATTAGGTCACGCGTGGCCAAT
CTGAAGGACCCCAAAAATCCTGGATTGCGAGGCAACTTTATGTGCGGCGC
CGTCACTGCCAAGCAGCTGGCCAAAATGACGCCGGAGGAGATGGCCAGCG
ATGAGATGAAGAAGCTGCGCGAGAAGTTCGTCAAGGAGGCCATCAACGAT
GCCCAGCTGGCCACCGTGCAGGGCACCAAGACCGATCTCCTCAAGTGCGC
CAAGTGCAAGAAGCGCAACTGCACCTACAACCAGCTGCAGACTCGTTCCG
CCGATGAACCTATGACCACCTTCGTCATGTGCAACGAGTGCGGCAACCGA
TGGAAGTTCTGCTAACTCCCAAAATTGTTCCAAAATATAAATCAATCCCA
AATGAGCACACACCACACATCCTTCATATTCTTAAATGAAACATTGTAAA
GACACGACACGCGAGAAAACATTTTGTATCTGCTGCCCAACTGCGGAGGC
GTTTACTCTGACCACCTAAACCTTAAACGAGAGAAAAGAAATTTCAATAA
ACATTAACTATTGATAAAACGGAGACGTCTTGTTGCCGCAATCAGTTTTT
TAAAAACGCCGGTGATAACGACCACGCTGCTGATAACTCGCCGATAACAC
AGCGGGGCGATAAATTGAGCATTGAGCAAAGTAAATATGAATACATTATA
AATATAACTCAGAATGATCTAGCAGAGAAGTAAATAAGACGCCATATTGT
GTATGTATTCTCGAAGAGTATTAACAACCGATGTAATTAGTCAGTTTTAA
AGCAATTTGCATTAACGAACTTTGTATTGCATTAAGTATAGAAGTCGGAA
CGGGCCAGATCGGACAACTATATCATATAGCGGGCATAGGAATAATTAAA
ACATTAACGCAAAATAAATATGTGTTCGTTGTGTTAGAAAAAAAAAAAAA
AAAAAAAA

LD34766.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:30:21
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIS-RA 1769 TfIIS-RA 83..1769 1..1687 8435 100 Plus
CG33679-RA 769 CG33679-RA 567..769 1688..1486 1015 100 Minus
CG8117-RA 770 CG8117-RA 323..439 871..987 270 82 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 14:02:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 15057714..15059161 1687..240 7120 99.4 Minus
chr2L 23010047 chr2L 15059227..15059466 240..1 1185 99.6 Minus
chrX 22417052 chrX 15534424..15534540 871..987 270 82.1 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:02:42
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIS-RB 942 CG3710-PB 1..942 174..1115 4710 100 Plus
TfIIS-RA 942 CG3710-PA 1..942 174..1115 4710 100 Plus
CG8117-RA 489 CG8117-PA 254..370 871..987 270 82.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:29:05 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:02:41
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIS-RB 1773 CG3710-RB 87..1773 1..1687 8435 100 Plus
TfIIS-RA 1401 CG3710-RA 87..1401 1..1315 6575 100 Plus
CG33679-RA 755 CG33679-RA 554..755 1687..1486 1010 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 14:02:44
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIS-PB 313 CG3710-PB 1..313 174..1112 1100 100 Plus
TfIIS-PA 313 CG3710-PA 1..313 174..1112 1100 100 Plus
CG8117-PA 162 CG8117-PA 1..161 618..1106 517 63.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:02:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15058918..15060366 1688..240 7245 100 Minus
2L 23513712 2L 15060432..15060671 240..1 1200 100 Minus
X 23542271 X 15644544..15644660 871..987 270 82.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:52:36
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15058918..15060366 1688..240 7245 100 Minus
2L 23513712 2L 15060432..15060671 240..1 1200 100 Minus
X 23527363 X 15652642..15652758 871..987 270 82 Plus
Blast to na_te.dros performed on 2014-11-27 14:02:40 has no hits.

LD34766.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:31:17 Download gff for LD34766.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 15059228..15059466 1..239 99   Minus
chr2L 15057714..15059161 240..1687 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:16:42 Download gff for LD34766.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIS-RA 1..942 174..1115 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:18:29 Download gff for LD34766.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIS-RA 1..942 174..1115 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:08:48 Download gff for LD34766.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIS-RA 1..942 174..1115 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:50:03 Download gff for LD34766.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIS-RA 1..942 174..1115 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:31:17 Download gff for LD34766.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIS-RA 1..942 174..1115 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:13:48 Download gff for LD34766.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIS-RA 83..1769 1..1687 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:18:29 Download gff for LD34766.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIS-RA 83..1769 1..1687 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:08:48 Download gff for LD34766.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIS-RB 87..1773 1..1687 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:50:03 Download gff for LD34766.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIS-RA 83..1769 1..1687 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:31:17 Download gff for LD34766.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIS-RB 87..1773 1..1687 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:31:17 Download gff for LD34766.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15060433..15060671 1..239 100   Minus
2L 15058919..15060366 240..1687 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:08:48 Download gff for LD34766.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 15060433..15060671 1..239 100   Minus
arm_2L 15058919..15060366 240..1687 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:28:18 Download gff for LD34766.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15060433..15060671 1..239 100   Minus
2L 15058919..15060366 240..1687 100 <- Minus

LD34766.pep Sequence

Translation from 173 to 1114

> LD34766.pep
MSVEEEVFRIQKKMSKMASDGTGQDQALDLLKALQTLNINLDILTKTRIG
MTVNELRKSSKDDEVIALAKTLIKNWKRFLASPAPTTPNNSSAKEGSSNN
SSASKSTSAAKSSSSISGKDKSSSSSSSKDKEKKGSTSSSQTSFPSGGMT
DAVRIKCREMLATALKIGEVPEGCGEPEEMAAELEDAIYSEFNNTDMKYK
NRIRSRVANLKDPKNPGLRGNFMCGAVTAKQLAKMTPEEMASDEMKKLRE
KFVKEAINDAQLATVQGTKTDLLKCAKCKKRNCTYNQLQTRSADEPMTTF
VMCNECGNRWKFC*

LD34766.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 04:59:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15561-PA 315 GF15561-PA 1..315 1..313 1345 87.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 04:59:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24225-PA 313 GG24225-PA 1..313 1..313 1414 96.8 Plus
Dere\GG17893-PA 162 GG17893-PA 1..161 149..311 599 65 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 04:59:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10818-PA 350 GH10818-PA 1..350 1..313 1257 75.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 04:59:50
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIS-PB 313 CG3710-PB 1..313 1..313 1589 100 Plus
TfIIS-PA 313 CG3710-PA 1..313 1..313 1589 100 Plus
CG8117-PA 162 CG8117-PA 1..161 149..311 576 63.8 Plus
pps-PA 2016 CG6525-PA 1219..1409 95..277 157 29.5 Plus
pps-PB 2018 CG6525-PB 1221..1411 95..277 157 29.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 04:59:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17330-PA 323 GI17330-PA 1..323 1..313 1265 83 Plus
Dmoj\GI24826-PA 2080 GI24826-PA 1246..1455 77..277 151 28.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 04:59:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25727-PA 313 GL25727-PA 1..313 1..313 1359 86 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 05:00:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17632-PA 313 GA17632-PA 1..313 1..313 1359 86 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 05:00:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14545-PA 311 GM14545-PA 1..311 1..313 1394 96.8 Plus
Dsec\GM22558-PA 162 GM22558-PA 1..161 149..311 585 61.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 05:00:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21972-PA 146 GD21972-PA 22..146 189..313 686 100 Plus
Dsim\GD17224-PA 141 GD17224-PA 1..140 170..311 511 59.9 Plus
Dsim\GD21971-PA 147 GD21971-PA 1..96 1..96 484 96.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 05:00:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TfIIS-PA 324 GJ15975-PA 1..324 1..313 1211 78.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 05:00:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18066-PA 319 GK18066-PA 1..319 1..313 1201 84.3 Plus
Dwil\GK14401-PA 2012 GK14401-PA 1184..1417 48..277 153 26.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 05:00:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19417-PA 313 GE19417-PA 1..313 1..313 1388 97.1 Plus
Dyak\GE17201-PA 162 GE17201-PA 1..161 149..311 608 65 Plus

LD34766.hyp Sequence

Translation from 173 to 1114

> LD34766.hyp
MSVEEEVFRIQKKMSKMASDGTGQDQALDLLKALQTLNINLDILTKTRIG
MTVNELRKSSKDDEVIALAKTLIKNWKRFLASPAPTTPNNSSAKEGSSNN
SSASKSTSAAKSSSSISGKDKSSSSSSSKDKEKKGSTSSSQTSFPSGGMT
DAVRIKCREMLATALKIGEVPEGCGEPEEMAAELEDAIYSEFNNTDMKYK
NRIRSRVANLKDPKNPGLRGNFMCGAVTAKQLAKMTPEEMASDEMKKLRE
KFVKEAINDAQLATVQGTKTDLLKCAKCKKRNCTYNQLQTRSADEPMTTF
VMCNECGNRWKFC*

LD34766.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:22:05
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIS-PB 313 CG3710-PB 1..313 1..313 1589 100 Plus
TfIIS-PA 313 CG3710-PA 1..313 1..313 1589 100 Plus
CG8117-PA 162 CG8117-PA 1..161 149..311 576 63.8 Plus
pps-PA 2016 CG6525-PA 1219..1409 95..277 157 29.5 Plus
pps-PB 2018 CG6525-PB 1221..1411 95..277 157 29.5 Plus