Clone LD34777 Report

Search the DGRC for LD34777

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:347
Well:77
Vector:pOT2
Associated Gene/TranscriptDiap2-RA
Protein status:LD34777.pep: gold
Preliminary Size:2177
Sequenced Size:2095

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8293 2001-01-01 Release 2 assignment
CG8293 2001-07-04 Blastp of sequenced clone
CG8293 2003-01-01 Sim4 clustering to Release 3
Iap2 2008-04-29 Release 5.5 accounting
Iap2 2008-08-15 Release 5.9 accounting
Iap2 2008-12-18 5.12 accounting

Clone Sequence Records

LD34777.complete Sequence

2095 bp (2095 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051844

> LD34777.complete
ATAAGTTTATATTTTTACCTTACCTTATTTTCATTTTCGTCTGCGCTCGC
TGGTGATTCCCTTGGTGGCATTACATCATTGGTGGATCCATTCGGATCCA
ATTTAGAAGCGCCACGATGACGGAGCTGGGCATGGAGCTGGAGAGCGTTC
GCCTGGCGACATTTGGGGAATGGCCCCTGAATGCCCCAGTTTCCGCGGAG
GATCTGGTCGCCAATGGTTTCTTTGCCACGGGAAACTGGCTGGAGGCCGA
GTGCCATTTCTGCCACGTGCGCATCGACCGCTGGGAATACGGCGATCAAG
TGGCGGAGCGCCATCGCCGCTCCTCGCCCATCTGCTCCATGGTTCTGGCT
CCCAATCACTGCGGCAATGTTCCCAGGAGCCAGGAGAGCGACAACGAGGG
AAACAGCGTAGTGGACAGCCCGGAGTCCTGCTCTTGTCCCGATCTCTTGT
TGGAGGCCAATCGCTTGGTAACTTTCAAGGACTGGCCGAATCCCAACATC
ACGCCGCAGGCTCTGGCAAAGGCAGGTTTCTACTACCTGAACCGTCTGGA
TCACGTGAAGTGTGTTTGGTGCAACGGAGTGATTGCCAAGTGGGAGAAGA
ACGACAATGCCTTTGAAGAGCACAAGCGCTTTTTTCCCCAATGTCCTCGT
GTGCAAATGGGCCCCCTTATAGAGTTTGCCACCGGGAAGAACCTGGATGA
GCTGGGCATCCAGCCCACCACTCTGCCACTGCGTCCCAAGTACGCCTGCG
TGGACGCCAGATTGAGAACCTTCACCGATTGGCCCATTTCCAATATTCAG
CCCGCTTCGGCTTTGGCGCAGGCTGGCCTATATTATCAGAAAATAGGCGA
CCAGGTGCGCTGTTTCCACTGCAACATTGGATTGCGCTCCTGGCAGAAGG
AGGACGAGCCGTGGTTCGAACACGCCAAGTGGTCGCCAAAGTGTCAGTTC
GTTTTGCTGGCCAAGGGTCCAGCCTATGTAAGCGAAGTGCTCGCGACAAC
AGCTGCCAACGCCAGTTCCCAGCCAGCAACTGCTCCGGCTCCAACGCTCC
AAGCAGACGTACTGATGGATGAAGCTCCGGCCAAGGAGGCCCTAGCCTTG
GGTATCGATGGAGGAGTTGTGCGCAATGCCATCCAGCGCAAGCTCTTGAG
TTCCGGCTGCGCTTTCTCTACGTTGGACGAACTATTGCATGACATCTTTG
ACGATGCGGGCGCAGGAGCTGCACTGGAGGTGCGCGAGCCGCCGGAGCCA
AGTGCTCCTTTTATTGAACCATGTCAGGCCACCACCAGCAAGGCAGCATC
TGTGCCAATACCGGTGGCCGATTCCATCCCAGCCAAACCACAGGCAGCTG
AAGCAGTGGCGAATATATCGAAAATCACAGACGAAATACAAAAGATGTCG
GTGGCCACGCCGAACGGAAACCTATCGCTGGAGGAGGAAAACCGCCAGCT
AAAGGATGCACGCTTATGCAAGGTATGCTTGGACGAGGAGGTTGGCGTAG
TGTTCCTGCCCTGTGGCCACTTGGCCACCTGCAATCAGTGCGCCCCCAGT
GTAGCCAATTGTCCCATGTGCCGCGCAGACATCAAGGGATTCGTGCGCAC
GTTCCTTTCGTGAAGTGCATATCGACATCATTTAGAGTTCACCAGCCTAG
TTAGCAGTTAAGCAAATCGATTGATTGCACCCACACAAACTACTACAGCG
AAGTTCAAATTATCCGGTGATTAGCTAATATAATCGTCTACTAATCGTCT
ACTAAGTACTTGGCCAACTGCAGCTATTCGTTTTTACATTAGCTACGGTT
GTAAGTTGTCGTTACTAACTATCGCATTGTGTCCGAGCGCATCCCTTTTG
AACCATACATTATGCACGCTGAAATGACCTTATATAGATGAGCAGCTCTA
ATTCGCGCTGAAAAGGGTATCAATGCACCGGCACGACCGCAGATCACATG
GATTTCTTGTTATAGTACTCTTATTAACACATGTATGTATTTTTGTTGAT
CATGTTTATAGGCCGCTGATAGTATGGTTTACACACAACTATATGCATTC
TCCAATAAATGTATATGTAAATGTTAAAAAAAAAAAAAAAAAAAA

LD34777.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:30:22
Subject Length Description Subject Range Query Range Score Percent Strand
Iap2-RA 2120 Iap2-RA 38..2118 1..2081 10405 100 Plus
Iap2-RB 2046 Iap2-RB 68..2044 105..2081 9885 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 23:51:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 11820053..11821089 1524..488 5185 100 Minus
chr2R 21145070 chr2R 11819439..11819990 2075..1524 2760 100 Minus
chr2R 21145070 chr2R 11821468..11821955 488..1 2440 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 23:51:50
Subject Length Description Subject Range Query Range Score Percent Strand
Diap2-RB 1497 CG8293-PB 1..1497 117..1613 7485 100 Plus
Diap2-RA 1497 CG8293-PA 1..1497 117..1613 7485 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:29:07 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:51:49
Subject Length Description Subject Range Query Range Score Percent Strand
Diap2-RA 2106 CG8293-RA 32..2106 1..2075 10375 100 Plus
Diap2-RB 1997 CG8293-RB 27..1997 105..2075 9855 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:51:53
Subject Length Description Subject Range Query Range Score Percent Strand
Diap2-PB 498 CG8293-PB 1..498 117..1610 2548 100 Plus
Diap2-PA 498 CG8293-PA 1..498 117..1610 2548 100 Plus
Diap1-PF 438 CG12284-PF 44..438 141..1610 398 28.4 Plus
Diap1-PE 438 CG12284-PE 44..438 141..1610 398 28.4 Plus
Diap1-PD 438 CG12284-PD 44..438 141..1610 398 28.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 23:51:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15932784..15933820 1524..488 5185 100 Minus
2R 25286936 2R 15932164..15932721 2081..1524 2790 100 Minus
2R 25286936 2R 15934199..15934686 488..1 2440 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:52:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 15933983..15935019 1524..488 5185 100 Minus
2R 25260384 2R 15933363..15933920 2081..1524 2790 100 Minus
2R 25260384 2R 15935398..15935885 488..1 2440 100 Minus
Blast to na_te.dros performed on 2014-11-26 23:51:47 has no hits.

LD34777.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:23:40 Download gff for LD34777.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 11821468..11821955 1..488 100   Minus
chr2R 11820053..11821088 489..1524 100 <- Minus
chr2R 11819439..11819989 1525..2075 95 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:16:44 Download gff for LD34777.complete
Subject Subject Range Query Range Percent Splice Strand
Iap2-RB 1..1497 117..1613 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:18:30 Download gff for LD34777.complete
Subject Subject Range Query Range Percent Splice Strand
Iap2-RB 1..1497 117..1613 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:20:50 Download gff for LD34777.complete
Subject Subject Range Query Range Percent Splice Strand
Iap2-RA 1..1497 117..1613 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:50:07 Download gff for LD34777.complete
Subject Subject Range Query Range Percent Splice Strand
Iap2-RB 1..1497 117..1613 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:23:40 Download gff for LD34777.complete
Subject Subject Range Query Range Percent Splice Strand
Diap2-RA 1..1497 117..1613 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:13:50 Download gff for LD34777.complete
Subject Subject Range Query Range Percent Splice Strand
Iap2-RA 58..2132 1..2075 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:18:30 Download gff for LD34777.complete
Subject Subject Range Query Range Percent Splice Strand
Iap2-RA 28..2102 1..2075 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:20:50 Download gff for LD34777.complete
Subject Subject Range Query Range Percent Splice Strand
Iap2-RA 32..2106 1..2075 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:50:07 Download gff for LD34777.complete
Subject Subject Range Query Range Percent Splice Strand
Iap2-RA 58..2132 1..2075 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:23:40 Download gff for LD34777.complete
Subject Subject Range Query Range Percent Splice Strand
Diap2-RA 32..2106 1..2075 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:23:40 Download gff for LD34777.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15934199..15934686 1..488 100   Minus
2R 15932784..15933819 489..1524 100 <- Minus
2R 15932170..15932720 1525..2075 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:20:50 Download gff for LD34777.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11821704..11822191 1..488 100   Minus
arm_2R 11820289..11821324 489..1524 100 <- Minus
arm_2R 11819675..11820225 1525..2075 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:28:19 Download gff for LD34777.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15935398..15935885 1..488 100   Minus
2R 15933983..15935018 489..1524 100 <- Minus
2R 15933369..15933919 1525..2075 100 <- Minus

LD34777.pep Sequence

Translation from 116 to 1612

> LD34777.pep
MTELGMELESVRLATFGEWPLNAPVSAEDLVANGFFATGNWLEAECHFCH
VRIDRWEYGDQVAERHRRSSPICSMVLAPNHCGNVPRSQESDNEGNSVVD
SPESCSCPDLLLEANRLVTFKDWPNPNITPQALAKAGFYYLNRLDHVKCV
WCNGVIAKWEKNDNAFEEHKRFFPQCPRVQMGPLIEFATGKNLDELGIQP
TTLPLRPKYACVDARLRTFTDWPISNIQPASALAQAGLYYQKIGDQVRCF
HCNIGLRSWQKEDEPWFEHAKWSPKCQFVLLAKGPAYVSEVLATTAANAS
SQPATAPAPTLQADVLMDEAPAKEALALGIDGGVVRNAIQRKLLSSGCAF
STLDELLHDIFDDAGAGAALEVREPPEPSAPFIEPCQATTSKAASVPIPV
ADSIPAKPQAAEAVANISKITDEIQKMSVATPNGNLSLEEENRQLKDARL
CKVCLDEEVGVVFLPCGHLATCNQCAPSVANCPMCRADIKGFVRTFLS*

LD34777.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 05:00:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13337-PA 497 GF13337-PA 1..497 1..498 2235 85 Plus
Dana\GF10661-PA 444 GF10661-PA 223..317 203..297 239 46.3 Plus
Dana\GF10661-PA 444 GF10661-PA 55..118 215..279 161 38.5 Plus
Dana\GF18137-PA 149 GF18137-PA 27..96 215..279 161 42.9 Plus
Dana\GF17464-PA 5004 GF17464-PA 230..359 184..316 157 34.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 05:00:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22322-PA 497 GG22322-PA 1..497 1..498 2534 95.2 Plus
Dere\GG13502-PA 400 GG13502-PA 4..308 6..333 299 29 Plus
Dere\GG17289-PA 4877 GG17289-PA 250..350 214..316 157 39.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 05:00:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20962-PA 502 GH20962-PA 3..502 2..498 1745 68.3 Plus
Dgri\GH15404-PA 449 GH15404-PA 59..293 113..288 336 31.5 Plus
Dgri\GH15404-PA 449 GH15404-PA 57..286 7..181 224 27.3 Plus
Dgri\GH15404-PA 449 GH15404-PA 52..122 205..276 158 36.1 Plus
Dgri\GH15404-PA 449 GH15404-PA 392..449 441..498 153 41.4 Plus
Dgri\GH13432-PA 141 GH13432-PA 20..92 215..282 146 39.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 05:00:31
Subject Length Description Subject Range Query Range Score Percent Strand
Diap2-PB 498 CG8293-PB 1..498 1..498 2670 100 Plus
Diap2-PA 498 CG8293-PA 1..498 1..498 2670 100 Plus
Diap1-PF 438 CG12284-PF 44..438 9..498 403 28.6 Plus
Diap1-PE 438 CG12284-PE 44..438 9..498 403 28.6 Plus
Diap1-PD 438 CG12284-PD 44..438 9..498 403 28.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 05:00:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21299-PA 500 GI21299-PA 1..500 1..498 1786 70.3 Plus
Dmoj\GI13007-PA 443 GI13007-PA 199..288 203..292 248 47.8 Plus
Dmoj\GI13007-PA 443 GI13007-PA 186..277 85..181 164 36.7 Plus
Dmoj\GI13007-PA 443 GI13007-PA 43..113 205..276 153 37.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 05:00:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16260-PA 493 GL16260-PA 1..493 1..498 2074 78.4 Plus
Dper\GL25100-PA 243 GL25100-PA 16..243 203..498 321 29.1 Plus
Dper\GL25100-PA 243 GL25100-PA 2..94 84..181 154 33.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 05:00:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20963-PA 493 GA20963-PA 1..493 1..498 2077 78.6 Plus
Dpse\GA11532-PA 439 GA11532-PA 212..439 203..498 320 30.1 Plus
Dpse\GA11532-PA 439 GA11532-PA 8..117 177..279 155 27.9 Plus
Dpse\GA11519-PA 152 GA11519-PA 31..103 215..282 151 38.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 05:00:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20110-PA 498 GM20110-PA 1..498 1..498 2611 98.6 Plus
Dsec\GM24450-PA 435 GM24450-PA 41..435 6..498 392 29.2 Plus
Dsec\GM26173-PA 3066 GM26173-PA 250..350 214..316 157 39.8 Plus
Dsec\GM16262-PA 341 GM16262-PA 54..154 214..316 156 39.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 05:00:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25587-PA 498 GD25587-PA 1..498 1..498 2607 98.2 Plus
Dsim\GD12518-PA 430 GD12518-PA 44..430 9..498 376 27.4 Plus
Dsim\GD20723-PA 4013 GD20723-PA 806..906 214..316 156 39.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 05:00:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20901-PA 491 GJ20901-PA 1..491 1..498 1812 71.9 Plus
Dvir\GJ12099-PA 456 GJ12099-PA 211..296 203..288 241 48.8 Plus
Dvir\GJ12099-PA 456 GJ12099-PA 57..289 9..181 214 27.8 Plus
Dvir\GJ12099-PA 456 GJ12099-PA 50..123 205..279 176 41.3 Plus
Dvir\GJ24423-PA 147 GJ24423-PA 25..97 215..282 148 38.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 05:00:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21897-PA 491 GK21897-PA 1..490 1..497 1668 64.6 Plus
Dwil\GK23971-PA 457 GK23971-PA 217..325 199..308 252 44.5 Plus
Dwil\GK23971-PA 457 GK23971-PA 44..119 203..279 159 36.4 Plus
Dwil\GK23971-PA 457 GK23971-PA 398..457 432..498 152 40.3 Plus
Dwil\GK11633-PA 151 GK11633-PA 6..101 95..182 149 38.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 05:00:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Iap2-PA 497 GE14118-PA 1..497 1..498 2526 94.8 Plus
Dyak\GE22287-PA 444 GE22287-PA 46..312 6..291 306 31.4 Plus
Dyak\GE23121-PA 444 GE23121-PA 46..312 6..291 306 31.4 Plus
Dyak\GE24690-PA 4970 GE24690-PA 250..350 214..316 157 39.8 Plus

LD34777.hyp Sequence

Translation from 116 to 1612

> LD34777.hyp
MTELGMELESVRLATFGEWPLNAPVSAEDLVANGFFATGNWLEAECHFCH
VRIDRWEYGDQVAERHRRSSPICSMVLAPNHCGNVPRSQESDNEGNSVVD
SPESCSCPDLLLEANRLVTFKDWPNPNITPQALAKAGFYYLNRLDHVKCV
WCNGVIAKWEKNDNAFEEHKRFFPQCPRVQMGPLIEFATGKNLDELGIQP
TTLPLRPKYACVDARLRTFTDWPISNIQPASALAQAGLYYQKIGDQVRCF
HCNIGLRSWQKEDEPWFEHAKWSPKCQFVLLAKGPAYVSEVLATTAANAS
SQPATAPAPTLQADVLMDEAPAKEALALGIDGGVVRNAIQRKLLSSGCAF
STLDELLHDIFDDAGAGAALEVREPPEPSAPFIEPCQATTSKAASVPIPV
ADSIPAKPQAAEAVANISKITDEIQKMSVATPNGNLSLEEENRQLKDARL
CKVCLDEEVGVVFLPCGHLATCNQCAPSVANCPMCRADIKGFVRTFLS*

LD34777.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:26:03
Subject Length Description Subject Range Query Range Score Percent Strand
Diap2-PB 498 CG8293-PB 1..498 1..498 2670 100 Plus
Diap2-PA 498 CG8293-PA 1..498 1..498 2670 100 Plus
Diap1-PF 438 CG12284-PF 44..438 9..498 403 28.6 Plus
Diap1-PE 438 CG12284-PE 44..438 9..498 403 28.6 Plus
Diap1-PD 438 CG12284-PD 44..438 9..498 403 28.6 Plus