Clone LD34837 Report

Search the DGRC for LD34837

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:348
Well:37
Vector:pOT2
Associated Gene/TranscriptSpt20-RA
Protein status:LD34837.pep: gold
Preliminary Size:6156
Sequenced Size:9337

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17689 2002-01-01 Sim4 clustering to Release 2
CG17689 2003-01-01 Sim4 clustering to Release 3
CG17689 2004-08-13 Blastp of sequenced clone
CG17689 2008-04-29 Release 5.5 accounting
CG17689 2008-08-15 Release 5.9 accounting
CG10627 2008-08-15 Release 5.9 accounting
CG17689 2008-12-18 5.12 accounting
CG10627 2008-12-18 5.12 accounting
CG17689-PA 2011-03-01 Transcript Validation

Clone Sequence Records

LD34837.complete Sequence

9337 bp (9337 high quality bases) assembled on 2004-08-13

GenBank Submission: BT016098

> LD34837.complete
AGTACATTTACATTGCAAAAAAAAGCATAAAACAAAGTTTTAAAACAATT
AAAAGCGAGCAATCCTCGGCGTATCATTAAAGAACCAGCCCACTGTTCGC
CCCATAACCGCAGCAGAGCGCGCGACCTTGCAAATTCACGGAGCAGCAGC
GCCAGAAAGAGAGTTCGTCGGCAGAGGGGCGCAGAGAGAAAATGTCACGC
AAAGCAGCAGCAGCAGTGGAAGTGGAAAAAGAGTGAAGAAACCGCAGTAA
TCGCCATCGGGATCCGATCTCAGTGTCCTCCAGTGCAGCGATTCGTCACA
CAGACGGACCGAGGAGCACCCCAAAACGATCCTGATGCGGCACAGCCGAG
TGCTGAGTGTGGCGAAACTAACCGATGGACAGCAGCAGCAGCAGCAGCAG
CCAGCGAAAGTAGGAGACAACAACGGAGCCCTGCGTCTGCGGTCCTAGAA
ATTCGTAATTCGACGTTCACTGGCAACACGGACACCTGCTAGCGCAATGC
GAATGCCGCCGATCCTGGCCAGGATTGTTCGTAGACTGGTGCTTGGATGT
CGTCGGTAATTGGGTGCGCCATCCTCCGTTGGATCTCCCCTAGCAATCCG
CTGGCACCACCATGCAAAGCCTGGACTCCTCATGCCAAGAAGCCGACTTT
ATTATAAATGACACGCTCAAAAAGTTAAAGGGTTCCAGCAACGCGGACCA
TGTCCAGGGCCTAGCGGTCCACGCCCACGGTTCGGGTGTCCACCAGACGC
AGTTCGTCCAGTACGGCACGTCTGGATCCTCGCCGCAGCTGCAGCCGCAG
CAGTCCTACCATCAGCTGCATCCCACGCTCCAGCAGCAGCAGTTCGCCTC
CTCGAGCAGCAAATCGTACCTGGAGACCAGCCTATTGCAGGCTATACCAC
AGATTCCTGCCCAGCCGCCCATTTGTATCTTCGATGACGACGAGTCCCCC
ACCGAGGGCACTGGCGGCTCACTGGGCAGCCTGCTCACGGAGCCGACCTC
GGCCACGCCCAGCGGCCTGCCCACTGCAATTGCTCCGTCGCCCTCCTCGT
GCTCATCCTCCACCACAACGATGTCGAACTTCAACTCAATCACGTCGCCG
TCGCCGGTGGTGCCCGATCTTCTGCTGTCGACACCGCCGGGCGTTAACTC
CAGTCTAAGCAATAGCTCAACGGGAGCGGCCAGTGTGTCCAGCAAGAAGT
CCGAGAAGCGGCCACCCTCCGCCAACTCAACAGCCAGTGGAGGCGGCCAC
CACCTGCACCATCATCACCTCCACCAGACGCACAATCACCATGTCCTGGC
ATCGCCCACGTCGTCGCCCAGCAAGCGCCAGAAGTCCAATAGCAGTAGCA
AGGAGAGCAGCTCCTCTAGTCGCAGCTCAGCTATACCCGCCGCATCAGTC
TCCACAGCCACCTCGTCGTCGCAATCAGCGCGCGCTGGCGCCGGCGCTGC
CTCCTCCAATAGCAACAGCAAGCCACCTTCATCCGTCTGCCAGTCGGGCA
ACAGCAAGTTCTTTAATCTGCACGAGAAAATAAGGGACCTGTACCTGCAA
CTGCTGAGCAACGACCTAAACTACTTTGCCGAGACAGGGCTAAAGCAGCG
CACTCGATCCTTTACACTGGAGCGGTTGGTGGATCGGGAGAAGCTCAACA
CGATTGTGGTCAACTTGTATCCCGGCAATAAGGGATACTCGCTGGCCCTG
CATTATGACGAGCACATGGTGCTAAATCCGCAAACAAACGAATGGTCCCC
CACGGACAAGGACGAGACCTCGAGCGATGCTGCGGGATTGGGTACGGGAA
CGGGCAGTCATCGGAGTCGTCCCAAGCCGCTAGCCCAGGACGAAAGTCAA
TCCAAGACGGAGGCGGGTCACGCCAAACACGATTTTGGACTCGTGGAGGT
GCTTCGGTGGCCCTACGAGAACGATTTGCTGCTGCAATGCATCGATCGTG
AAATGCTGCCGGAGTTTTTAATGGATCTACTCGTAGCGGAGACCGTCAGT
TTGTCGGATGGCGAGGGAACACGGGTGTACGCCAAGCCTAGCGTCTTCTA
TGCCGGCTGCGTTATCGCCCAGATCCGCGACTTCCGCCAGACATTTGCCA
CCTCAACGAATATCTGTGATATGAAGCACATCCTGCTCAGGCCCACGAAC
GCCACCCTATTCGCGGAAGTGCAGCAAATGGGCAGCCAGTTGCCGGCGGA
GGACAAGCTCGCCCTGGAGAGCCAGCTGGTGTTGGCCACGGCGGAGCCGC
TGTGTCTGGAGCCGGATCCCAGCATAGGGCGGCAGGCCATCAACTCCCAG
CATCAGCGTCAGCTGTACAACTCCCACGAGCTGCGGCGCCAGATGAAGAA
GTTCACCCAAACGGCTATCAATCGGAAGCGCAAGTTGGACCAATTCACTC
ACCATCACGGACTGGAATTGTGCGATTACCTGGCTCGCCTGCGCCAGCGA
CCGCGGACGGGAAGTAGCAGTGGTGGCGCCAATGCCACACCGGCCACGGC
GCCCACCAACAATCCGCTGGTGGGGGCCATGCTCTCTTCGTTCACATCGA
AGGTGCCCCGGCGACCACACGAGGTCATACGGCCCATTCGTCCGCCCACA
CTGGAGTATCCCGCCAATCTGAAGGTGCCCGAGCACGTGATCAGCGTGGA
AAAGTATGCCAAGGCCTACGAGCCCCTTAACGAATTCAGTGAGGCCTGCA
AGGACGGTTGCCAGCCAAACTGTCGTCATAACTTCCAACCGCAGCTGGTC
GAGGAATACATTCTTGAGACGGAGCGGGAGGCGAGTGAAGGCCGGCGGGC
TCTATACCACATAAAGCTGTCCATTTTCCAGCGCCCCTCCGATGCAGAGT
ATCTCGGCGAGCTCTATGTGGACCGAGATTACCGGGAGGGTGAGCGAAAC
GGCGAGTCGTGCCGCTTTGCGCTGGGCACTCGGGTGCATGCCAATCGATA
CATTCAACAGTTCCGCGAGATCTTCACCGAGGAGGGACGTAAGGCGGTCA
AAATCACGCATTTGATACCCGGGCATATGCCAATTGTGACTCACACGGGA
TTGACGAATGAGCAGCGGATCCTCTTGCAGCAGCAACAACAGCAGCAGCA
GCGTCAAGCTCAAATGCAGCAGCAACAACAACAGCAGCAGCAGCAAGTCG
TTGTTGTTGCCAATCAGCAGCAACAATCGCAACAACAACAGCAGACACAA
CAAGCGGGACAGCAGTTATCCGCCACAGTGCATCATGTTGCACTGCCGCG
ACAACAAATAACTCAAAAGACTCTCAATTTGGCTGGAAGTAATGTAATCA
ATGTACAACAAAACTTTCGGCAACAATCAGCGCAGCAGCAGCAGCCGCAA
ACATACACAATTGAGGCACCGCAGCAGCAAGCTGCAGCACAGATTGTCCC
GCAACAACAGCAGCAGCAGCAGCAGCAACAACAACAACACATACATCTTC
AGCAGTTGGCCACCGGCAGCAGCAATACCTCCACAACAACGCACCAAGTT
AGCCTCAGCAATGGTTCCCTGGTCCTTGTGCAACAGCAGCAGCCACAGCA
GCAATCGCAACAGCTGGCACAGGCGCTGCAACATTCGGGCATAACCATCC
AGCCCGCCACCATTCAACAGCAGCAACAGCAGGTGAAGGGCACTTCCGTG
GTGGGGGCCAATTCAGCGCTGCGTGCCCAGCTCAACTCAAATGTGCCAAT
ACTGCAAACGCAGCTGAAAGTGCAGCAGCAACAGATTATGCAGAAGCAAC
AGCAACAACAGACAACTGCCACTAGTAACAACAACAACAACAATAATAAC
AATAACAATATGAACAACAATACGGCCATACATCCGAATCCTGCAATAAA
CGCCATAGTCAACAGCATTATGAACTCTGCCAACCAGTACCAGCAACAAC
AGCAGCAGCAACACCAGCAGCAGCATCAGCAGCAAACGGGGAACACGTCG
AGCAACAATAATGCTGCAGGGTCAGGCGGCAGCACCAACAACAACGGAAG
TAGCACCAGTGCCACAACCCTCAAGAACTCCAGCAATGCGTCAATTTTAA
ACCTGCTCAACAGTGCTCCAGCTGCGATGACCAGCACACCCGTGGCCAGT
GGAACGTTCACCACCTCCACCGGCCAGCAGCAACCGCAGACGCTGACGCT
TGTGCAGCACCAGCAACAGTCGACGCCAAACACTGCCGATGCGGCCACCG
CTACGTATGTGCAGACCACCCGTGGCACACCCACGCTGGTGAGTACGCAG
CGGAAGCAGCAGTCCAGCGAAGTGTTGCAAAATCTGTTGAACGCCAATCG
AAAGATTGGTGGCGGAGGCACCACAACGACAACTTTTCGAACAAACTCCG
CGGGCAATTTGATAGCGGTCAACCTCAACCAAGCCGGCCAGTCGCATCAC
CAACAGACAGGCGACGGCAGCCAGACGGTTAGAGTGTCCATGTCGGCGCT
TGCCTCGCAGTTGGCCTCGCCGCCCGCAGTGATGACAAACCCCACCACCA
GCTACACAGTGATCTCGTCGGGCAACAGTGCCGCGGCGGCGGCAGCATGG
ATTCAGAGCCCAACGGGCCCAGTTCAGCAGCGCATTCTGAGCTCCCTGAG
AAGAGATAGCACCACAGCGCCGCCCAACGCAATTGTGGTGGGCATGGCCG
CTCCTTCTCCAGGTAGCGATTCGAACGCCTCGAATGCCAGTGGCTTTGCT
GTGCCAAACAATCTAGCGTCCACTTCAAGTGGTGGTGGCGGCGGTGGTGG
AGCCCTGTCCGCCTTGCTGACCAACGCAGCAACTCCCTCGCCATCGGGCT
CGGATCACTCGCAGTCGTCGCAGACGCACCAAAACCAAGCCCTGCTGGAG
CGCCTAAGCAATGTCACATCAAACGTATCCGCCGTTTCCATGCCGCACAT
GTCACCGCAACAGCCGCAGCCAACGCAGCAGTTCATCACGAAAACCATCG
TTCACTCTCCCGCCACATCTTCGATACACTCGCCCATGTCTAGTCCGCAT
CCGCAGCCCTCTGCCTCGCCGCAGCAGCAACAACAGCAGCAGCAGCAACA
GACCACCGCCACTTTGAATCTGCAGGGCATCAATCTGTCTCAACTGCAGG
GCGCTATGGCTAACTTTGCCGGCCTGCAGAATGTCCAGGTGCAGATCCCC
GGCTTCACACAGCCCATTTCGCTGCAGTTCTCCGGTAACAGTTTGCAGCA
ACAACAGTCGGGTAATACGGCTACTGGTGCGGGCACAGCGCAGGGCCAAC
AGAGAAGTGTCCTGGTCTCGGTTCCAGTCTCCAGCCAACAACAGCAACTG
CCACACACCATAACGCTGCAGACTCAGTCGGCGCCGCACCACCAGCAGCA
GCATCAGCAGACTCAGCAGCAACATGCCCCACCAACGGGCACCATTGTGA
GCCTGCCATCGTCGGGACCTGGCACACAGACGGTCGTCATTACGAATAAC
TCCGGCGGAGGAGTGACGGCGGGAAGCAGCACCAGTGGCAGTGCGGGCGG
CGGTGGAGGATCAGGGGCCACAACGGCCATGCTCACCCTTCCCATTGCTC
AAATAGTCGGTGCCGGTGTACAGAAACTAAATCCTCAAACAATACGTACC
TCAAATGTTGGTGGTGGTATAGGTATCGCCCAGCAAACGGTCCAGCAGCA
GACGATTCAGTCGCAGTCGGGCGGCAACAGCACCGCGGCCATCCAGCTGC
TGGGCACCATACAGCCGCGTGCCCGCAACGTCCAGGTGGTGGGCACCAAG
CAATTGGCCAACAGGCAGCTCATCACCACCCAGCGGCAGATAGGTGGCTC
CACGCTTAAGATCGCCACCACACCCGTGAACGCTGCCAATGTGGTGACCA
GCAGCGCCAACCTAACCACCACTCCGATTGTGATGTCCGCACAGAAGCTG
CAATTGAAAACGGTGAAGGCGCCCGTGCAACAGCAGCAACAGCCTCAGCA
ACAGCAACAGCAGCTGCAGCAACAGCACCGAATACTCAACCAGCAGAGCA
CGGCCACGGTGTCGTCGCAAACACTGCCCAGTCCCAACCAAGTGCAGGTG
GCCCAGCAGCAGCAGCAGCAGCAACAGCAGCTGCAGCACATTCAGATCGC
CGGTAGGGCCACCACCGCTTCGGGAGCCATCAGTCAAAGGACTCTAACAG
CTCTGGCGGCTGCGAAGCAGCAGCAGCAGCAACAACAGGCTGCGGTCAAT
CGACGGCGCTCCACCACCGATGCGACCAAGTAAGGGATGTGAATTGCCTG
GAACTGAGACGACTATTGGGACGACTGAGAGATGAAGCTATAGAGCGAAC
AAGTAGAAGGCTACGCGTTGTGTATTGCTTGATATTATAGTTTATGGTTA
CCTCCTAACTATCACTACTATCGTACATTGTATACCCATATAACTATATA
TGTTTTGATGTGTAATCGTAAGTGTAAATTGCATGGGCAACAGCATGGCA
GCTCATAGTTGTGCAACCTAGTTAGGAGCTGGAATTGGAGCCGAAACACA
ATCGGTCTGGCCCGGCTCCACCGACTGCGCTTGGGGTAATTGGGTACCCC
CCCCCCCCCCCCCGGCAAAAACGAATTAGGTGTAGAGGTCTTAATAATAT
TTATCTAGTTGTATATACGCATATATATTACATATATATTATATATATAT
ATGGAAATTGTTTCAATATGTCCCGCGCCCAATGGCCATTTAAACTACTA
CTATTTGGCTCCCGACTCCAATTCGTTAAGTCCTAAGACTAATTCTTTAA
GCGTGCTAATTTTAAGCTGTAAATCAGGGGAGGGGAGGAGTCGACGGTAA
CAAAAGGAAAGCAATAATATGAGGAGAAAAATCAAGAGAAACGTAAAAAT
TAATTGTAAAGAAATTCTAATTATTACGATTACGTTTAGCTGCGAGAGCA
TATGAACCGGGGTAGGGGTTCATTTAAGCAATTACAAATATTCATATTGT
ACTATTAAAATTATTATTGCTAATTATTTAATCGATTGCTTAGCTTAAGT
TCACAAACGAAGATAAAACACACACATTTTAGTTTGTAATGTACAATTCG
TAGCCTCAACCAATTTAGTACTTCCAATTGCAGATACATTAAAAACGAAG
AGCAAAACAAAAAAAAAAAAAAAAAACTCGAACGACGGTCACACCCGCCT
GCACACATCTGTGGAATTGTTAAATTTCGAAAGTCCGGAAAAACCGGACG
GAACCTTTCACCTCGCTCTGGACCAGTGGCACCGCCCTCGAGTATCGCAA
GATGTCTATTAACCTGCGCACCGTCTACGCCTTCGCCCGCGAGATGTACC
CAAAGACCTCCAAGGAGACCATCCAATATGGAACAGCTGGCTTTCGCGGC
AAGGCTGAGTTCCTGGACAGCGTGATGTTCCGCATGGGCGTTCTGGCCAC
CCTGCGTTCCCGGTATCGCGGAGGCTCCGTCATCGGTGTGATGATCACGG
CATCGCACAATCCGGAGCCGGACAACGGAGTGAAGCTGGTCGATCCCAAG
GGCGAGATGCTGGAGGCCAGCTGGGAGGCGATAGCCACCGATCTGGTCAA
CGTCAGCGACCAGGAGCTGGAGCAGCAGGTGGCCAAGATCATAAAGGACA
ACAATATCGATGTGACGACCAGTTCCCAGGTGTTTGTGGGCATGGACAAC
AGATACCACAGTCCGCGGCTGCTGAAAGCGGTGGCCGATGGCGTGATAGC
GCTAAAGGGTAACGTCAAGGAGTACGGCATTGTGACCACACCCATGCTGC
ACTACTTCGTGGTGGCGGCGAATACCAAGGAGGCATACGGCAAGCCCACC
GAGGAGGGTTACTACGACAAGCTGATCAAGGCATTCGAACTGCTGCGCAA
CGGGCGCCTGGAGAACGGCAACTATCGCAATAGCATCATCTACGATGGTG
CCAACGGTGTGGGTGCGCGCAAGATGCTGCAGTTCATCAAGCGCATGAAG
GGCACCCTCAACGTGACGGTCATTAATCAGGGCATCGGTGTCGGCAAGAT
CAACGAGGACTGCGGCGCCGACTACGTGAAGGTGCAGCAAAGTCCGCCGA
AATCCATGCCCGAGGATGTGAAGCCGTACACGAGATGCGTCAGCGTGGAT
GGCGATGCCGATCGGGTGGTGTACTTCTTTACCGACGACAAGGGTGAGTT
CCATCTGCTCGATGGCGATCGCATAGCCACCCTAATCGCCGGCTATCTCA
TGGAACTGGTCACACAATCCGAGATTAGCCTACGGCTGGGCCTGGTGCAA
ACTGCCTACGCCAATGGTGCATCCACGGACTACATAGTGGACCAGCTGAA
GTTTCCCGTTTCGTGCGTACCCACGGGCGTGAAGCACCTGCACCACAAGG
CCTTGGAGTACGACATTGGTGTTTACTTCGAGGCGAATGGCCACGGAACG
ATTGTGTTCAGTGACAATGCTAAGGCGACGATTGCCCAGGTGGCCCAAAC
TAAGGAGAGTGCCAAGACGTTGCTGCTGCTCATCGATCTTATCAACGAGA
CCGTGGGCGATGCCATATCCGACATGCTGCTGGTGGAAACAATCCTAAAT
CACAAGGGCTGGGATGTCCAGGATTGGATCTCGTCGTACAACGATCTGCC
CAACCGACAGCTAAAGGTGAAGGTGCAGGATCGCAATGTCATCGAGACGA
CGGATGCGGAACGCGTGTGCGTAAAGCCCGAAGGTCTGCAGACGGAAATC
AACCAGGTGGTGGCGAAATACAAGCGGGGACGCTCCTTCGTTCGCCCCTC
GGGCACCGAGGATGTGGTGCGCGTCTATGCCGAAGCAGCCACCAAAGAGG
ACACCGATAATCTTGCCTACGAAGTGGGTCTGCTGGTCCAGAAACTGGCC
GGCGGAGTTGGCCCCCCATTGACGAAGCCCAACAGCAGTGCCCACCTGTA
GAGCGGAATGACGAACTAACCTCTCACGGGAATCGACAATTGACACAGAT
CCTGGATGGAGCAATAAATCTCTTTACTCTAAGGTGCTCAATAACTTAAA
AAAAAAACAACTTAACTCTCAAACGCATTTATTCTGCAAATGTTCACTGT
CTTTTGTGTTCTAAAGATGACATATTTTTTGCCATTATTTATAAAGTTCT
TTTCAAGTTTATTTATACATATGTACATTGTGAAAGTTGCAATTTTATGT
CCTTCGCTATTTTGTAATTGAAGAATTTAATGAAAATGCAACCGCTACGT
TGATTTTTTTGTTGAGCTGCTAGCGGTAACTATTGAAATTATAAAAGAAT
TGATAGTAGAGATTAATGAACCTAATCAAGTTTGTATTGCTATTTTCTAT
AAAAGTATTTTTTAAACAAAAAAAAAAAAAAAAAAAA

LD34837.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:23:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG17689.d 7315 CG17689.d 101..7211 1..7112 35475 99.9 Plus
CG17689.c 7821 CG17689.c 101..7211 1..7112 35475 99.9 Plus
CG17689.b 7845 CG17689.b 101..7211 1..7112 35475 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 23:52:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 13494680..13496795 1589..3704 10550 99.9 Plus
chr3L 24539361 chr3L 13497160..13498770 3937..5547 7965 99.6 Plus
chr3L 24539361 chr3L 12518400..12519847 8800..7353 7195 99.8 Minus
chr3L 24539361 chr3L 13499622..13500892 5832..7112 6025 98.2 Plus
chr3L 24539361 chr3L 13493681..13494626 648..1593 4655 99.5 Plus
chr3L 24539361 chr3L 13492963..13493609 1..647 3205 99.7 Plus
chr3L 24539361 chr3L 12517814..12518333 9317..8798 2555 99.4 Minus
chr3L 24539361 chr3L 13499274..13499559 5547..5832 1400 99.3 Plus
chr3L 24539361 chr3L 13496864..13497096 3704..3936 1165 100 Plus
chr3L 24539361 chr3L 12520532..12520754 7353..7131 1115 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 23:52:09
Subject Length Description Subject Range Query Range Score Percent Strand
Spt20-RD 5622 CG17689-PD 1..5622 612..6233 28110 100 Plus
Spt20-RA 5622 CG17689-PA 1..5622 612..6233 28110 100 Plus
Spt20-RC 4941 CG17689-PC 1..4936 612..5547 24680 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:29:11 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:52:06
Subject Length Description Subject Range Query Range Score Percent Strand
Spt20-RD 7161 CG17689-RD 32..7142 1..7112 35465 99.9 Plus
Spt20-RA 8007 CG17689-RA 32..7142 1..7112 35465 99.9 Plus
Spt20-RC 7335 CG17689-RC 32..5578 1..5547 27735 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:52:16
Subject Length Description Subject Range Query Range Score Percent Strand
Spt20-PC 1646 CG17689-PC 1..1087 612..3872 3345 100 Plus
Spt20-PD 1873 CG17689-PD 1..1087 612..3872 3345 100 Plus
Spt20-PA 1873 CG17689-PA 1..1087 612..3872 3345 100 Plus
nst-PA 549 CG10627-PA 1..549 7252..8898 2815 100 Plus
Spt20-PD 1873 CG17689-PD 1156..1873 4077..6230 1707 100 Plus
Spt20-PA 1873 CG17689-PA 1156..1873 4077..6230 1707 100 Plus
Spt20-PC 1646 CG17689-PC 1156..1645 4077..5546 1058 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 23:51:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13504455..13506570 1589..3704 10580 100 Plus
3L 28110227 3L 13506935..13508545 3937..5547 8055 100 Plus
3L 28110227 3L 12527801..12529248 8800..7353 7240 100 Minus
3L 28110227 3L 13509397..13510676 5832..7112 6310 99.7 Plus
3L 28110227 3L 13503456..13504401 648..1593 4715 99.9 Plus
3L 28110227 3L 13502738..13503384 1..647 3235 100 Plus
3L 28110227 3L 12527213..12527734 9319..8798 2610 100 Minus
3L 28110227 3L 13509049..13509334 5547..5832 1430 100 Plus
3L 28110227 3L 13506639..13506871 3704..3936 1165 100 Plus
3L 28110227 3L 12529934..12530156 7353..7131 1115 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:11:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 13497555..13499670 1589..3704 10580 100 Plus
3L 28103327 3L 13500035..13501645 3937..5547 8055 100 Plus
3L 28103327 3L 12520901..12522348 8800..7353 7240 100 Minus
3L 28103327 3L 13502497..13503776 5832..7112 6320 99.6 Plus
3L 28103327 3L 13496556..13497501 648..1593 4715 99.8 Plus
3L 28103327 3L 13495838..13496484 1..647 3235 100 Plus
3L 28103327 3L 12520313..12520834 9319..8798 2610 100 Minus
3L 28103327 3L 13502149..13502434 5547..5832 1430 100 Plus
3L 28103327 3L 13499739..13499971 3704..3936 1165 100 Plus
3L 28103327 3L 12523034..12523256 7353..7131 1115 100 Minus
Blast to na_te.dros performed 2014-11-26 23:52:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2334..2989 3078..3789 386 57.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2356..2936 3061..3632 386 57.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2478..2982 3078..3564 369 58.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6531..7036 3529..4027 362 59.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2305..2892 3465..4031 341 57.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6725..7079 3399..3756 300 58.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2459..2912 3710..4188 299 58 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..7062 3418..3779 244 59.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6718..7118 3533..3930 239 57.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6757..7189 3530..3937 206 55.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6711..6827 5272..5386 182 67.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6770..6880 5286..5395 182 68.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2282..2406 5261..5386 176 63 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6740..6842 5286..5386 167 66.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6791..6893 5286..5386 167 66.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6749..6840 5286..5374 163 69.9 Plus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3192..3322 3433..3562 155 63.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2340..2428 5286..5374 147 65.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2336..2396 5333..5394 145 72.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2337..2433 5286..5385 141 64.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2394..2493 5286..5386 140 66 Plus
roo 9092 roo DM_ROO 9092bp 1082..1148 5319..5386 139 69.1 Plus
gypsy11 4428 gypsy11 GYPSY11 4428bp 911..1003 5284..5374 137 65.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1492..1587 5276..5373 134 61.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2790..2886 5286..5386 134 64.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6724..6778 5333..5388 133 73.2 Plus
roo 9092 roo DM_ROO 9092bp 1111..1145 3530..3564 130 85.7 Plus
roo 9092 roo DM_ROO 9092bp 1087..1146 782..841 129 68.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6746..6799 5334..5388 128 72.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2327..2388 5333..5392 125 69.4 Plus
roo 9092 roo DM_ROO 9092bp 1084..1138 5333..5388 124 71.4 Plus
roo 9092 roo DM_ROO 9092bp 1096..1154 5315..5373 124 67.8 Plus

LD34837.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:23:44 Download gff for LD34837.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 13499623..13499716 5833..5926 100 == Plus
chr3L 13499275..13499559 5548..5832 99 -> Plus
chr3L 13497160..13498770 3937..5547 97 -> Plus
chr3L 13496983..13497050 3823..3890 100 == Plus
chr3L 13496865..13496906 3705..3746 100 == Plus
chr3L 13496237..13496795 3146..3704 92 -> Plus
chr3L 13494681..13496167 1590..3076 99 == Plus
chr3L 13493681..13494622 648..1589 99 -> Plus
chr3L 13492963..13493609 1..647 96 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:56:19 Download gff for LD34837.complete
Subject Subject Range Query Range Percent Splice Strand
CG17689-RA 1..5622 612..6233 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:48:12 Download gff for LD34837.complete
Subject Subject Range Query Range Percent Splice Strand
Spt20-RA 1..5622 612..6233 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:20:53 Download gff for LD34837.complete
Subject Subject Range Query Range Percent Splice Strand
Spt20-RA 1..5622 612..6233 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:42:00 Download gff for LD34837.complete
Subject Subject Range Query Range Percent Splice Strand
CG17689-RA 1..5622 612..6233 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:23:44 Download gff for LD34837.complete
Subject Subject Range Query Range Percent Splice Strand
Spt20-RA 1..5622 612..6233 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:56:18 Download gff for LD34837.complete
Subject Subject Range Query Range Percent Splice Strand
CG17689-RA 1..6533 3..6535 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:48:11 Download gff for LD34837.complete
Subject Subject Range Query Range Percent Splice Strand
Spt20-RA 1..7105 3..7108 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:20:53 Download gff for LD34837.complete
Subject Subject Range Query Range Percent Splice Strand
Spt20-RA 32..7138 1..7108 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:42:00 Download gff for LD34837.complete
Subject Subject Range Query Range Percent Splice Strand
CG17689-RA 1..6533 3..6535 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:23:44 Download gff for LD34837.complete
Subject Subject Range Query Range Percent Splice Strand
Spt20-RA 32..7138 1..7108 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:23:44 Download gff for LD34837.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13509398..13510685 5833..7121 99 == Plus
3L 13509050..13509334 5548..5832 100 -> Plus
3L 13506935..13508545 3937..5547 100 -> Plus
3L 13506640..13506871 3705..3936 100 -> Plus
3L 13504456..13506570 1590..3704 100 -> Plus
3L 13503456..13504397 648..1589 100 -> Plus
3L 13502738..13503384 1..647 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:20:53 Download gff for LD34837.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13502498..13503785 5833..7121 99 == Plus
arm_3L 13502150..13502434 5548..5832 100 -> Plus
arm_3L 13500035..13501645 3937..5547 100 -> Plus
arm_3L 13499740..13499971 3705..3936 100 -> Plus
arm_3L 13497556..13499670 1590..3704 100 -> Plus
arm_3L 13496556..13497497 648..1589 100 -> Plus
arm_3L 13495838..13496484 1..647 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:33:38 Download gff for LD34837.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13502498..13503785 5833..7121 99 == Plus
3L 13502150..13502434 5548..5832 100 -> Plus
3L 13500035..13501645 3937..5547 100 -> Plus
3L 13499740..13499971 3705..3936 100 -> Plus
3L 13497556..13499670 1590..3704 100 -> Plus
3L 13496556..13497497 648..1589 100 -> Plus
3L 13495838..13496484 1..647 100 -> Plus

LD34837.pep Sequence

Translation from 611 to 6232

> LD34837.pep
MQSLDSSCQEADFIINDTLKKLKGSSNADHVQGLAVHAHGSGVHQTQFVQ
YGTSGSSPQLQPQQSYHQLHPTLQQQQFASSSSKSYLETSLLQAIPQIPA
QPPICIFDDDESPTEGTGGSLGSLLTEPTSATPSGLPTAIAPSPSSCSSS
TTTMSNFNSITSPSPVVPDLLLSTPPGVNSSLSNSSTGAASVSSKKSEKR
PPSANSTASGGGHHLHHHHLHQTHNHHVLASPTSSPSKRQKSNSSSKESS
SSSRSSAIPAASVSTATSSSQSARAGAGAASSNSNSKPPSSVCQSGNSKF
FNLHEKIRDLYLQLLSNDLNYFAETGLKQRTRSFTLERLVDREKLNTIVV
NLYPGNKGYSLALHYDEHMVLNPQTNEWSPTDKDETSSDAAGLGTGTGSH
RSRPKPLAQDESQSKTEAGHAKHDFGLVEVLRWPYENDLLLQCIDREMLP
EFLMDLLVAETVSLSDGEGTRVYAKPSVFYAGCVIAQIRDFRQTFATSTN
ICDMKHILLRPTNATLFAEVQQMGSQLPAEDKLALESQLVLATAEPLCLE
PDPSIGRQAINSQHQRQLYNSHELRRQMKKFTQTAINRKRKLDQFTHHHG
LELCDYLARLRQRPRTGSSSGGANATPATAPTNNPLVGAMLSSFTSKVPR
RPHEVIRPIRPPTLEYPANLKVPEHVISVEKYAKAYEPLNEFSEACKDGC
QPNCRHNFQPQLVEEYILETEREASEGRRALYHIKLSIFQRPSDAEYLGE
LYVDRDYREGERNGESCRFALGTRVHANRYIQQFREIFTEEGRKAVKITH
LIPGHMPIVTHTGLTNEQRILLQQQQQQQQRQAQMQQQQQQQQQQVVVVA
NQQQQSQQQQQTQQAGQQLSATVHHVALPRQQITQKTLNLAGSNVINVQQ
NFRQQSAQQQQPQTYTIEAPQQQAAAQIVPQQQQQQQQQQQQHIHLQQLA
TGSSNTSTTTHQVSLSNGSLVLVQQQQPQQQSQQLAQALQHSGITIQPAT
IQQQQQQVKGTSVVGANSALRAQLNSNVPILQTQLKVQQQQIMQKQQQQQ
TTATSNNNNNNNNNNNMNNNTAIHPNPAINAIVNSIMNSANQYQQQQQQQ
HQQQHQQQTGNTSSNNNAAGSGGSTNNNGSSTSATTLKNSSNASILNLLN
SAPAAMTSTPVASGTFTTSTGQQQPQTLTLVQHQQQSTPNTADAATATYV
QTTRGTPTLVSTQRKQQSSEVLQNLLNANRKIGGGGTTTTTFRTNSAGNL
IAVNLNQAGQSHHQQTGDGSQTVRVSMSALASQLASPPAVMTNPTTSYTV
ISSGNSAAAAAAWIQSPTGPVQQRILSSLRRDSTTAPPNAIVVGMAAPSP
GSDSNASNASGFAVPNNLASTSSGGGGGGGALSALLTNAATPSPSGSDHS
QSSQTHQNQALLERLSNVTSNVSAVSMPHMSPQQPQPTQQFITKTIVHSP
ATSSIHSPMSSPHPQPSASPQQQQQQQQQQTTATLNLQGINLSQLQGAMA
NFAGLQNVQVQIPGFTQPISLQFSGNSLQQQQSGNTATGAGTAQGQQRSV
LVSVPVSSQQQQLPHTITLQTQSAPHHQQQHQQTQQQHAPPTGTIVSLPS
SGPGTQTVVITNNSGGGVTAGSSTSGSAGGGGGSGATTAMLTLPIAQIVG
AGVQKLNPQTIRTSNVGGGIGIAQQTVQQQTIQSQSGGNSTAAIQLLGTI
QPRARNVQVVGTKQLANRQLITTQRQIGGSTLKIATTPVNAANVVTSSAN
LTTTPIVMSAQKLQLKTVKAPVQQQQQPQQQQQQLQQQHRILNQQSTATV
SSQTLPSPNQVQVAQQQQQQQQQLQHIQIAGRATTASGAISQRTLTALAA
AKQQQQQQQAAVNRRRSTTDATK*

LD34837.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 17:44:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23471-PA 1887 GF23471-PA 1..1887 1..1873 6063 79.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 17:45:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15651-PA 1876 GG15651-PA 1..1876 1..1873 7135 96 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 17:45:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14823-PA 2033 GH14823-PA 378..995 298..889 2444 75.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 17:44:39
Subject Length Description Subject Range Query Range Score Percent Strand
Spt20-PD 1873 CG17689-PD 1..1873 1..1873 9489 100 Plus
Spt20-PA 1873 CG17689-PA 1..1873 1..1873 9489 100 Plus
Spt20-PC 1646 CG17689-PC 1..1645 1..1645 8389 100 Plus
ptip-PA 2294 CG32133-PA 180..1251 806..1868 391 24.1 Plus
ptip-PA 2294 CG32133-PA 863..1638 821..1610 365 26.5 Plus
Ncoa6-PC 2265 CG14023-PC 1144..2151 818..1757 338 21.7 Plus
ptip-PA 2294 CG32133-PA 1154..1618 817..1239 264 28.6 Plus
ptip-PA 2294 CG32133-PA 1001..1283 813..1133 255 32.1 Plus
Spt20-PC 1646 CG17689-PC 829..1562 1092..1859 219 21.1 Plus
ptip-PA 2294 CG32133-PA 1083..1356 817..1107 216 29.9 Plus
ptip-PA 2294 CG32133-PA 1319..1667 823..1108 181 28.8 Plus
ptip-PA 2294 CG32133-PA 1429..1730 803..1108 181 30.2 Plus
ptip-PA 2294 CG32133-PA 1309..1699 804..1135 171 26.6 Plus
ptip-PA 2294 CG32133-PA 1199..1674 815..1226 170 25.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 17:46:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13929-PA 1926 GI13929-PA 1..882 1..822 2872 67.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 17:46:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22093-PA 1708 GL22093-PA 1..1703 1..1651 5099 78.4 Plus
Dper\GL22104-PA 200 GL22104-PA 2..200 1665..1873 469 75.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 17:46:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28253-PA 1926 GA28253-PA 1..1926 1..1873 5699 77.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 17:46:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25427-PA 1461 GM25427-PA 1..571 1..572 2559 96.9 Plus
Dsec\GM25427-PA 1461 GM25427-PA 865..1428 1051..1613 2146 98.8 Plus
Dsec\GM25427-PA 1461 GM25427-PA 689..852 629..792 965 99.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 17:46:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14455-PA 1807 GD14455-PA 604..1807 672..1873 4045 96.5 Plus
Dsim\GD14455-PA 1807 GD14455-PA 1..604 1..604 2732 98.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 17:47:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13717-PA 1964 GJ13717-PA 1..883 1..822 2961 69.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 17:47:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17076-PA 1999 GK17076-PA 284..1089 266..1091 2787 73.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 17:47:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21977-PA 1873 GE21977-PA 1..1873 1..1873 7032 96.3 Plus

LD34837.hyp Sequence

Translation from 611 to 6232

> LD34837.hyp
MQSLDSSCQEADFIINDTLKKLKGSSNADHVQGLAVHAHGSGVHQTQFVQ
YGTSGSSPQLQPQQSYHQLHPTLQQQQFASSSSKSYLETSLLQAIPQIPA
QPPICIFDDDESPTEGTGGSLGSLLTEPTSATPSGLPTAIAPSPSSCSSS
TTTMSNFNSITSPSPVVPDLLLSTPPGVNSSLSNSSTGAASVSSKKSEKR
PPSANSTASGGGHHLHHHHLHQTHNHHVLASPTSSPSKRQKSNSSSKESS
SSSRSSAIPAASVSTATSSSQSARAGAGAASSNSNSKPPSSVCQSGNSKF
FNLHEKIRDLYLQLLSNDLNYFAETGLKQRTRSFTLERLVDREKLNTIVV
NLYPGNKGYSLALHYDEHMVLNPQTNEWSPTDKDETSSDAAGLGTGTGSH
RSRPKPLAQDESQSKTEAGHAKHDFGLVEVLRWPYENDLLLQCIDREMLP
EFLMDLLVAETVSLSDGEGTRVYAKPSVFYAGCVIAQIRDFRQTFATSTN
ICDMKHILLRPTNATLFAEVQQMGSQLPAEDKLALESQLVLATAEPLCLE
PDPSIGRQAINSQHQRQLYNSHELRRQMKKFTQTAINRKRKLDQFTHHHG
LELCDYLARLRQRPRTGSSSGGANATPATAPTNNPLVGAMLSSFTSKVPR
RPHEVIRPIRPPTLEYPANLKVPEHVISVEKYAKAYEPLNEFSEACKDGC
QPNCRHNFQPQLVEEYILETEREASEGRRALYHIKLSIFQRPSDAEYLGE
LYVDRDYREGERNGESCRFALGTRVHANRYIQQFREIFTEEGRKAVKITH
LIPGHMPIVTHTGLTNEQRILLQQQQQQQQRQAQMQQQQQQQQQQVVVVA
NQQQQSQQQQQTQQAGQQLSATVHHVALPRQQITQKTLNLAGSNVINVQQ
NFRQQSAQQQQPQTYTIEAPQQQAAAQIVPQQQQQQQQQQQQHIHLQQLA
TGSSNTSTTTHQVSLSNGSLVLVQQQQPQQQSQQLAQALQHSGITIQPAT
IQQQQQQVKGTSVVGANSALRAQLNSNVPILQTQLKVQQQQIMQKQQQQQ
TTATSNNNNNNNNNNNMNNNTAIHPNPAINAIVNSIMNSANQYQQQQQQQ
HQQQHQQQTGNTSSNNNAAGSGGSTNNNGSSTSATTLKNSSNASILNLLN
SAPAAMTSTPVASGTFTTSTGQQQPQTLTLVQHQQQSTPNTADAATATYV
QTTRGTPTLVSTQRKQQSSEVLQNLLNANRKIGGGGTTTTTFRTNSAGNL
IAVNLNQAGQSHHQQTGDGSQTVRVSMSALASQLASPPAVMTNPTTSYTV
ISSGNSAAAAAAWIQSPTGPVQQRILSSLRRDSTTAPPNAIVVGMAAPSP
GSDSNASNASGFAVPNNLASTSSGGGGGGGALSALLTNAATPSPSGSDHS
QSSQTHQNQALLERLSNVTSNVSAVSMPHMSPQQPQPTQQFITKTIVHSP
ATSSIHSPMSSPHPQPSASPQQQQQQQQQQTTATLNLQGINLSQLQGAMA
NFAGLQNVQVQIPGFTQPISLQFSGNSLQQQQSGNTATGAGTAQGQQRSV
LVSVPVSSQQQQLPHTITLQTQSAPHHQQQHQQTQQQHAPPTGTIVSLPS
SGPGTQTVVITNNSGGGVTAGSSTSGSAGGGGGSGATTAMLTLPIAQIVG
AGVQKLNPQTIRTSNVGGGIGIAQQTVQQQTIQSQSGGNSTAAIQLLGTI
QPRARNVQVVGTKQLANRQLITTQRQIGGSTLKIATTPVNAANVVTSSAN
LTTTPIVMSAQKLQLKTVKAPVQQQQQPQQQQQQLQQQHRILNQQSTATV
SSQTLPSPNQVQVAQQQQQQQQQLQHIQIAGRATTASGAISQRTLTALAA
AKQQQQQQQAAVNRRRSTTDATK*

LD34837.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:23:09
Subject Length Description Subject Range Query Range Score Percent Strand
Spt20-PD 1873 CG17689-PD 1..1873 1..1873 9489 100 Plus
Spt20-PA 1873 CG17689-PA 1..1873 1..1873 9489 100 Plus
Spt20-PC 1646 CG17689-PC 1..1645 1..1645 8389 100 Plus
ptip-PA 2294 CG32133-PA 180..1251 806..1868 391 24.1 Plus
ptip-PA 2294 CG32133-PA 863..1638 821..1610 365 26.5 Plus
Ncoa6-PC 2265 CG14023-PC 1144..2151 818..1757 338 21.7 Plus
ptip-PA 2294 CG32133-PA 1154..1618 817..1239 264 28.6 Plus
ptip-PA 2294 CG32133-PA 1001..1283 813..1133 255 32.1 Plus
Spt20-PC 1646 CG17689-PC 829..1562 1092..1859 219 21.1 Plus
ptip-PA 2294 CG32133-PA 1083..1356 817..1107 216 29.9 Plus
ptip-PA 2294 CG32133-PA 1319..1667 823..1108 181 28.8 Plus
ptip-PA 2294 CG32133-PA 1429..1730 803..1108 181 30.2 Plus
ptip-PA 2294 CG32133-PA 1309..1699 804..1135 171 26.6 Plus
ptip-PA 2294 CG32133-PA 1199..1674 815..1226 170 25.3 Plus