Clone LD35003 Report

Search the DGRC for LD35003

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:350
Well:3
Vector:pOT2
Associated Gene/Transcriptmdlc-RA
Protein status:LD35003.pep: gold
Preliminary Size:1501
Sequenced Size:1403

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4973 2001-01-01 Release 2 assignment
CG4973 2001-07-04 Blastp of sequenced clone
CG4973 2003-01-01 Sim4 clustering to Release 3
CG4973 2008-04-29 Release 5.5 accounting
CG4973 2008-08-15 Release 5.9 accounting
CG4973 2008-12-18 5.12 accounting

Clone Sequence Records

LD35003.complete Sequence

1403 bp (1403 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051847

> LD35003.complete
CGAAATTGCTATTGTTAATTGTTGTTAACGTGAATTACTAGATAAGTACA
TAAATTTAAAAGCCGGAGAATGTCGGAAGAAGCGGCTAGCACCTCGTCCT
TTGGCTTCAAGAAGCGGAACCTCAAGAAGGGAGCTGGAATTCGTCGCAAA
AAGGAAACCAGCAGTGATGAATCTGCAAAAAGCAGCGATGAAGAGACCAA
AGGCAAAGCCAGTGCTCTGGTGCGAGCCGAGAACCGCCGAAAGCGCACGA
ATCCCAACTTCCAGAGCACCAAGACAATGAGCAAAGCAAAGAGACAGGCG
GGAGGAGTTGGTGATGATGGCTCATCCTCAGCCTCCGACGATGATAAACT
GGGCATTGCGTACAAATCCAAACGCGAGGCGCTGCCCAGTGGACCCCAAG
ATCAGGGAGCTACATCGATTAACGAAATGGACACAGAATTGGATCGCGAT
GCGCAGGCAATTCATGCGCGAGCTCTGAAAATCAACGAAGAGCTGGAGGG
CAAGGCGGACGATAAGATCTATCGCGGAATTAACAACTATGCGCAGTACT
ACAAGAAGCAGGATACAGCGGCAGGGAATGCCAGCTCCGGAATGGTACGA
AGTGGCCCAATTAGGGCTCCTGCCCATCTTAGGGCCACTGTCAGGTGGGA
TTATCAGCCGGATATATGCAAGGATTACAAGGAAACAGGATATTGCGGCT
TTGGCGACAGCTGTAAGTTTCTGCACGATCGCAGTGATTACAAAGCGGGC
TGGCAATTGGAAATGGATCACGAAAATCAGCGAACGGGTGATGTAGACTC
CGATGGCGATGATACCAAGTATGAGATTCACTCCGATGAAGAAACACTGC
CTTTCAAGTGCCACATCTGCCGACAGAGTTTTGTCAATCCCGTGGTAACA
AAGTGCAAGCACTATTTCTGTGAAAAGTGCGCCTTGGCCCAGTACAAAAA
GTCACAGCGCTGCATCATCTGTTCCCAGCAAACAAATGGTATTTTCAATC
CCGCCAAAGAGCTGATAGCTCGCCTCAAGACAAACCCAATGGAAAACTCA
GATAGTGATGAGGAGGAGGAATTTGGGAAAAAGGAGGATAAAGCGGAAGC
AGGGGAGGAAGCTCAGGAGATTTCTTCGGATGATAGTGATTAAAATATTT
TTTTAAATCATTTATACAGGTTGTGAAAGTAAATAGGGACATTGATTAGA
TGCTTCACATAAAATCCATTTTACAGCACATTTGCCGCATAAGTGTAGAA
AGTAAAGTAAGGATTGTACCACCGATAGGTGGCGTGTAAGAAATTGTAAA
ACCCTTTGCCCCAAAGAGAATTGCTGATAAATCACTATTCTTACTTGTAA
CTAGAAAAATATATTTTGATAAGTTTTCAACCAAAAAAAAAAAAAAAAAA
AAA

LD35003.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:30:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG4973-RA 1441 CG4973-RA 41..1428 1..1388 6925 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:40:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 15881961..15882690 175..904 3620 99.7 Plus
chr3R 27901430 chr3R 15882756..15883233 903..1382 2290 99 Plus
chr3R 27901430 chr3R 15881729..15881903 1..175 875 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:40:23
Subject Length Description Subject Range Query Range Score Percent Strand
mdlc-RA 1074 CG4973-PA 1..1074 70..1143 5370 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:29:21 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:40:21
Subject Length Description Subject Range Query Range Score Percent Strand
mdlc-RA 1419 CG4973-RA 38..1419 1..1382 6910 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:40:25
Subject Length Description Subject Range Query Range Score Percent Strand
mdlc-PA 357 CG4973-PA 1..357 70..1140 1550 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:40:18
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20058017..20058746 175..904 3650 100 Plus
3R 32079331 3R 20058812..20059297 903..1388 2415 99.8 Plus
3R 32079331 3R 20057785..20057959 1..175 875 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:52:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 19798848..19799577 175..904 3650 100 Plus
3R 31820162 3R 19799643..19800128 903..1388 2415 99.7 Plus
3R 31820162 3R 19798616..19798790 1..175 875 100 Plus
Blast to na_te.dros performed on 2014-11-26 19:40:20 has no hits.

LD35003.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:25:52 Download gff for LD35003.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 15882756..15883233 903..1382 93   Plus
chr3R 15881962..15882688 176..902 99 -> Plus
chr3R 15881729..15881903 1..175 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:17:01 Download gff for LD35003.complete
Subject Subject Range Query Range Percent Splice Strand
CG4973-RA 1..1074 70..1143 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:18:21 Download gff for LD35003.complete
Subject Subject Range Query Range Percent Splice Strand
CG4973-RA 1..1074 70..1143 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:51:52 Download gff for LD35003.complete
Subject Subject Range Query Range Percent Splice Strand
CG4973-RA 1..1074 70..1143 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:49:56 Download gff for LD35003.complete
Subject Subject Range Query Range Percent Splice Strand
CG4973-RA 1..1074 70..1143 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:25:52 Download gff for LD35003.complete
Subject Subject Range Query Range Percent Splice Strand
mdlc-RA 1..1074 70..1143 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:13:34 Download gff for LD35003.complete
Subject Subject Range Query Range Percent Splice Strand
CG4973-RA 36..1417 1..1382 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:18:21 Download gff for LD35003.complete
Subject Subject Range Query Range Percent Splice Strand
CG4973-RA 36..1417 1..1382 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:51:52 Download gff for LD35003.complete
Subject Subject Range Query Range Percent Splice Strand
CG4973-RA 38..1419 1..1382 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:49:56 Download gff for LD35003.complete
Subject Subject Range Query Range Percent Splice Strand
CG4973-RA 36..1417 1..1382 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:25:52 Download gff for LD35003.complete
Subject Subject Range Query Range Percent Splice Strand
mdlc-RA 38..1419 1..1382 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:25:52 Download gff for LD35003.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20058812..20059291 903..1382 100   Plus
3R 20058018..20058744 176..902 100 -> Plus
3R 20057785..20057959 1..175 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:51:52 Download gff for LD35003.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15884534..15885013 903..1382 100   Plus
arm_3R 15883740..15884466 176..902 100 -> Plus
arm_3R 15883507..15883681 1..175 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:28:09 Download gff for LD35003.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19799643..19800122 903..1382 100   Plus
3R 19798849..19799575 176..902 100 -> Plus
3R 19798616..19798790 1..175 100 -> Plus

LD35003.pep Sequence

Translation from 69 to 1142

> LD35003.pep
MSEEAASTSSFGFKKRNLKKGAGIRRKKETSSDESAKSSDEETKGKASAL
VRAENRRKRTNPNFQSTKTMSKAKRQAGGVGDDGSSSASDDDKLGIAYKS
KREALPSGPQDQGATSINEMDTELDRDAQAIHARALKINEELEGKADDKI
YRGINNYAQYYKKQDTAAGNASSGMVRSGPIRAPAHLRATVRWDYQPDIC
KDYKETGYCGFGDSCKFLHDRSDYKAGWQLEMDHENQRTGDVDSDGDDTK
YEIHSDEETLPFKCHICRQSFVNPVVTKCKHYFCEKCALAQYKKSQRCII
CSQQTNGIFNPAKELIARLKTNPMENSDSDEEEEFGKKEDKAEAGEEAQE
ISSDDSD*

LD35003.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 04:54:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17636-PA 353 GF17636-PA 1..353 1..357 1526 83.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 04:54:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23724-PA 356 GG23724-PA 1..356 1..357 1704 94.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 04:54:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22886-PA 364 GH22886-PA 1..360 1..354 1480 78.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 04:54:16
Subject Length Description Subject Range Query Range Score Percent Strand
mdlc-PA 357 CG4973-PA 1..357 1..357 1880 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 04:54:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22714-PA 360 GI22714-PA 1..329 1..324 1449 82.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 04:54:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12088-PA 358 GL12088-PA 1..358 1..357 1557 82.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 04:54:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18564-PA 358 GA18564-PA 1..358 1..357 1559 83.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 04:54:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17684-PA 356 GM17684-PA 1..356 1..357 1701 96.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 04:54:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19337-PA 356 GD19337-PA 1..356 1..357 1744 97.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 04:54:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23438-PA 366 GJ23438-PA 1..331 1..325 1502 84 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 04:54:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22373-PA 357 GK22373-PA 1..357 1..357 1396 79.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 04:54:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25648-PA 356 GE25648-PA 1..356 1..357 1644 93.8 Plus

LD35003.hyp Sequence

Translation from 69 to 1142

> LD35003.hyp
MSEEAASTSSFGFKKRNLKKGAGIRRKKETSSDESAKSSDEETKGKASAL
VRAENRRKRTNPNFQSTKTMSKAKRQAGGVGDDGSSSASDDDKLGIAYKS
KREALPSGPQDQGATSINEMDTELDRDAQAIHARALKINEELEGKADDKI
YRGINNYAQYYKKQDTAAGNASSGMVRSGPIRAPAHLRATVRWDYQPDIC
KDYKETGYCGFGDSCKFLHDRSDYKAGWQLEMDHENQRTGDVDSDGDDTK
YEIHSDEETLPFKCHICRQSFVNPVVTKCKHYFCEKCALAQYKKSQRCII
CSQQTNGIFNPAKELIARLKTNPMENSDSDEEEEFGKKEDKAEAGEEAQE
ISSDDSD*

LD35003.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:57:16
Subject Length Description Subject Range Query Range Score Percent Strand
mdlc-PA 357 CG4973-PA 1..357 1..357 1880 100 Plus