Clone LD35155 Report

Search the DGRC for LD35155

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:351
Well:55
Vector:pOT2
Associated Gene/TranscriptCG9609-RA
Protein status:LD35155.pep: gold
Preliminary Size:1801
Sequenced Size:1574

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9609 2001-01-01 Release 2 assignment
CG9609 2001-07-04 Blastp of sequenced clone
CG9609 2003-01-01 Sim4 clustering to Release 3
CG9609 2008-04-29 Release 5.5 accounting
CG9609 2008-08-15 Release 5.9 accounting
CG9609 2008-12-18 5.12 accounting

Clone Sequence Records

LD35155.complete Sequence

1574 bp (1574 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051849

> LD35155.complete
CTTACCAGGGACATCATCGATTTTCTACACCAAATTAAAAGAAACCTATA
AGTTATAGATTTGCTACACCAAATTGAAATAAAATCAATCTCTTCAACCT
TAAGTCCTTGGCTATTTCCACGTACACGAGTGTGGCCAAATAATTCCACG
ACATTTGCGGATGTCGCGGTAACCTAAAACACAAAAAAAAAAGAGATTGC
AATATTTCGGAGATAAAAACCCTCAAAAATGCCGCCTGGAACGCAAATTG
CCAGCGACAGCGATATGGAGACCGCTCTGGAGGAGTTCAAGCAGCGCCAG
GGACGCCGCAACAGCATCGGCTCGGCCAAGTACGCGTGCAGCATGCCCAA
ATGCGAGGCCACATTCAAGCGGCTGGACCAATTGGATCGCCATGAGTATC
ATCACACAGGGATTAAGAAGCACGCCTGCTCGTACGAGGGTTGCGACAAG
ACGTACTCGATTGTGACGCACTTAAAGAGGCATCTGCGCAGCACCCACGA
GCGTCCGGAGTCGGCGGCCAAGAAGACGGTGAAGTGCGCGCTGGAGGAGT
GCAGCAAGATGTTCATCTCGGTTAGCAACATGACCCGCCACATGCGCGAA
ACCCACGAGAGCCCAAAGGTCTATCCGTGCAGCCAGTGCAGTGCCAAATT
CTCGCAAAAGCTCAAGCTGAAGCGCCACGAGATCAGGGAGCACACGCTGG
AGTATCCGTACAGCTGCTCGAAGTGCTCGCGCGGCTTCTACCAGCAGTGG
CAGTGCCAGAGTCACGAGCCCAGCTGCAAGCTGTACGAGTGTCCCGGCTG
CCCGCTGCAGTTCGACAAATGGACGTTGTATACGAAGCATTGTCGCGACT
CGTTGCACGGCAAGAATCGCCATAAGTGCGACCGCTGCGATAGTGCCTTC
GACAAGCCGAGCGAACTGAAGCGTCACCTCGAGGTGAAGCACAAGGAGGC
GGCGCAGACGGATGAGTGCGCCACCTCCTTCACCTGCAACGAGGAGGGAT
GCGGCAAGAGTTACTCGTACCTCAGGAATCTACGCCAGCACATGCTCACC
GCCCACTCGGGCAGGCGTTTCGAGTGCCAGGCCTTGGACTGCGGCCGCTG
TTTCAGCAGTGCGCAGAATCTGGCGAGACATCTGCTCAGGGATCACAAAG
ATGGTGCGACGAAAAAGGAATTGAAAGCCAAGAAGAAGGACAAGAGTAAG
ACTGGAGAAGGGGGCAAAACTAAGTCCACATCCCGCAAGCGACGACGCGA
TGCTGGACGCAGCAAACATTCGAGGCTATCCAAACTGGCCTGCCTGCAAT
TGGACAAGGAAGATGATGAGGCGGTGCGCGAGCGACAGCCTTTGGTCCTC
GAAAAGATCACCCAGTCGCTGAAGGATGACCCCGTCGAGGAGCTGCTGGC
ACAGACCCTGCAGGATGAAGAGGAAAAGGAGCAGGAGTAGAGCAAAAGGC
CATTCAAAGGGACGGGAGTGAGAAGGTCTGGTCAAGAGGCTAACAATTGA
ATGACTACTTTAATTTAAACCACAACTTCTAAAAGAGAAACAACTAATTT
ATCAGTAAAAAAAAAAAAAAAAAA

LD35155.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:30:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG9609-RA 1822 CG9609-RA 41..1599 1..1559 7795 100 Plus
Paf-AHalpha.a 1433 Paf-AHalpha.a 148..219 93..164 255 90.2 Plus
Paf-AHalpha.d 1503 Paf-AHalpha.d 218..289 93..164 255 90.2 Plus
Paf-AHalpha.a 1433 Paf-AHalpha.a 92..142 1..51 150 86.2 Plus
Paf-AHalpha.d 1503 Paf-AHalpha.d 162..212 1..51 150 86.2 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 23:52:29
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 16674997..16676138 1556..415 5695 99.9 Minus
chrX 22417052 chrX 16676199..16676612 414..1 2070 100 Minus
chr2L 23010047 chr2L 20899446..20899543 191..94 385 92.9 Minus
chr2R 21145070 chr2R 5646851..5646956 87..192 365 89.6 Plus
chrX 22417052 chrX 15675212..15675357 192..56 300 83.6 Minus
chr2L 23010047 chr2L 21613098..21613184 190..104 240 85.1 Minus
chrX 22417052 chrX 8298828..8298884 190..133 225 96.6 Minus
chr4 1351717 chr4 730349..730437 190..103 215 85.4 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 23:52:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG9609-RA 1212 CG9609-PA 1..1212 229..1440 6060 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:29:32 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:52:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG9609-RA 1834 CG9609-RA 31..1586 1..1556 7780 100 Plus
Paf-AHalpha-RB 1435 CG8962-RB 91..236 56..192 300 83.6 Plus
Paf-AHalpha-RA 1507 CG8962-RA 91..236 56..192 300 83.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:52:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG9609-PA 403 CG9609-PA 1..396 229..1416 1946 100 Plus
CG32772-PE 520 CG32772-PE 132..382 340..1146 274 28.4 Plus
CG32772-PC 520 CG32772-PC 132..382 340..1146 274 28.4 Plus
crol-PG 878 CG14938-PG 293..576 292..1131 274 28.9 Plus
CG5245-PA 501 CG5245-PA 49..322 238..1146 273 26.5 Plus
CG5245-PA 501 CG5245-PA 198..463 352..1134 224 27.4 Plus
CG5245-PA 501 CG5245-PA 331..491 328..930 181 26.9 Plus
CG5245-PA 501 CG5245-PA 356..490 319..765 166 31.5 Plus
CG5245-PA 501 CG5245-PA 367..490 280..678 156 35.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 23:52:20
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16785360..16786504 1559..415 5725 100 Minus
X 23542271 X 16786565..16786978 414..1 2070 100 Minus
2L 23513712 2L 20900910..20901008 192..94 390 92.9 Minus
2R 25286936 2R 9759414..9759519 87..192 365 89.6 Plus
X 23542271 X 15785348..15785493 192..56 300 83.6 Minus
2L 23513712 2L 21614604..21614690 190..104 240 85.1 Minus
X 23542271 X 8407081..8407137 190..133 225 96.6 Minus
4 1348131 4 709787..709875 190..103 215 85.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:52:32
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 16793458..16794602 1559..415 5725 100 Minus
X 23527363 X 16794663..16795076 414..1 2070 100 Minus
2L 23513712 2L 20900910..20901008 192..94 390 92.9 Minus
2R 25260384 2R 9760589..9760718 66..192 370 86.9 Plus
X 23527363 X 15793480..15793551 164..93 255 90.2 Minus
2L 23513712 2L 21614604..21614690 190..104 240 85 Minus
X 23527363 X 8415179..8415235 190..133 235 96.5 Minus
4 1331231 4 709787..709875 190..103 225 85.3 Minus
X 23527363 X 15793557..15793607 51..1 150 86.2 Minus
Blast to na_te.dros performed 2014-11-26 23:52:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmir\spock 4952 Dmir\spock SPOCK 4952bp Derived from AY144571. 4829..4952 86..207 201 64.8 Plus
Dana\Tom 7060 Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). 2494..2552 39..97 115 66.1 Plus

LD35155.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:23:47 Download gff for LD35155.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 16676199..16676612 1..414 100   Minus
chrX 16674997..16676138 415..1556 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:17:13 Download gff for LD35155.complete
Subject Subject Range Query Range Percent Splice Strand
CG9609-RA 1..1212 229..1440 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:18:24 Download gff for LD35155.complete
Subject Subject Range Query Range Percent Splice Strand
CG9609-RA 1..1212 229..1440 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:20:55 Download gff for LD35155.complete
Subject Subject Range Query Range Percent Splice Strand
CG9609-RA 1..1212 229..1440 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:49:58 Download gff for LD35155.complete
Subject Subject Range Query Range Percent Splice Strand
CG9609-RA 1..1212 229..1440 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:23:47 Download gff for LD35155.complete
Subject Subject Range Query Range Percent Splice Strand
CG9609-RA 1..1212 229..1440 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:13:38 Download gff for LD35155.complete
Subject Subject Range Query Range Percent Splice Strand
CG9609-RA 1..1554 1..1554 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:18:24 Download gff for LD35155.complete
Subject Subject Range Query Range Percent Splice Strand
CG9609-RA 1..1554 1..1554 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:20:55 Download gff for LD35155.complete
Subject Subject Range Query Range Percent Splice Strand
CG9609-RA 31..1586 1..1556 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:49:58 Download gff for LD35155.complete
Subject Subject Range Query Range Percent Splice Strand
CG9609-RA 1..1554 1..1554 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:23:47 Download gff for LD35155.complete
Subject Subject Range Query Range Percent Splice Strand
CG9609-RA 31..1586 1..1556 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:23:47 Download gff for LD35155.complete
Subject Subject Range Query Range Percent Splice Strand
X 16786565..16786978 1..414 100   Minus
X 16785363..16786504 415..1556 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:20:55 Download gff for LD35155.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16680598..16681011 1..414 100   Minus
arm_X 16679396..16680537 415..1556 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:28:12 Download gff for LD35155.complete
Subject Subject Range Query Range Percent Splice Strand
X 16794663..16795076 1..414 100   Minus
X 16793461..16794602 415..1556 100 <- Minus

LD35155.pep Sequence

Translation from 228 to 1439

> LD35155.pep
MPPGTQIASDSDMETALEEFKQRQGRRNSIGSAKYACSMPKCEATFKRLD
QLDRHEYHHTGIKKHACSYEGCDKTYSIVTHLKRHLRSTHERPESAAKKT
VKCALEECSKMFISVSNMTRHMRETHESPKVYPCSQCSAKFSQKLKLKRH
EIREHTLEYPYSCSKCSRGFYQQWQCQSHEPSCKLYECPGCPLQFDKWTL
YTKHCRDSLHGKNRHKCDRCDSAFDKPSELKRHLEVKHKEAAQTDECATS
FTCNEEGCGKSYSYLRNLRQHMLTAHSGRRFECQALDCGRCFSSAQNLAR
HLLRDHKDGATKKELKAKKKDKSKTGEGGKTKSTSRKRRRDAGRSKHSRL
SKLACLQLDKEDDEAVRERQPLVLEKITQSLKDDPVEELLAQTLQDEEEK
EQE*

LD35155.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 04:55:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22286-PA 409 GF22286-PA 1..392 1..403 1489 69.2 Plus
Dana\GF23532-PA 693 GF23532-PA 185..440 40..302 224 26.5 Plus
Dana\GF20350-PA 545 GF20350-PA 178..416 38..277 216 29.1 Plus
Dana\GF10913-PA 862 GF10913-PA 269..546 42..331 216 24.4 Plus
Dana\GF23400-PA 940 GF23400-PA 496..703 27..241 203 31.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 04:56:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18225-PA 402 GG18225-PA 1..401 1..402 1820 87.6 Plus
Dere\GG15333-PA 708 GG15333-PA 200..457 38..302 231 25.9 Plus
Dere\GG18735-PA 522 GG18735-PA 136..407 38..327 223 27.3 Plus
Dere\GG14073-PA 864 GG14073-PA 275..552 42..331 211 24.4 Plus
Dere\GG18916-PA 506 GG18916-PA 91..387 41..306 204 27.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 04:56:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24929-PA 403 GH24929-PA 1..396 1..397 1222 59.1 Plus
Dgri\GH24873-PA 528 GH24873-PA 179..422 27..322 229 28.2 Plus
Dgri\GH16297-PA 872 GH16297-PA 272..525 42..302 214 24.4 Plus
Dgri\GH15154-PA 756 GH15154-PA 225..478 42..302 210 24.8 Plus
Dgri\GH13073-PA 979 GH13073-PA 525..732 27..241 202 31.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 04:55:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG9609-PA 403 CG9609-PA 1..403 1..403 2185 100 Plus
CG32772-PE 520 CG32772-PE 132..403 38..327 279 27.4 Plus
CG32772-PC 520 CG32772-PC 132..403 38..327 279 27.4 Plus
crol-PG 878 CG14938-PG 293..583 22..309 277 29.2 Plus
CG5245-PA 501 CG5245-PA 49..322 4..306 273 26.5 Plus
CG5245-PA 501 CG5245-PA 198..463 42..302 224 27.4 Plus
CG5245-PA 501 CG5245-PA 331..491 34..234 181 26.9 Plus
CG5245-PA 501 CG5245-PA 356..490 31..179 166 31.5 Plus
CG5245-PA 501 CG5245-PA 367..490 18..150 156 35.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 04:56:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15446-PA 392 GI15446-PA 1..372 1..383 1258 62.1 Plus
Dmoj\GI14705-PA 529 GI14705-PA 165..408 27..322 230 28.2 Plus
Dmoj\GI12092-PA 660 GI12092-PA 138..391 42..302 219 26.3 Plus
Dmoj\GI13238-PA 869 GI13238-PA 272..553 42..335 217 24.4 Plus
Dmoj\GI17692-PA 965 GI17692-PA 509..716 27..241 202 31.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 04:56:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26765-PA 385 GL26765-PA 1..382 1..398 1377 65.2 Plus
Dper\GL17891-PA 464 GL17891-PA 228..424 28..236 248 34.6 Plus
Dper\GL13105-PA 510 GL13105-PA 155..453 27..366 227 25.8 Plus
Dper\GL26275-PA 880 GL26275-PA 534..852 17..306 217 27.5 Plus
Dper\GL15564-PA 859 GL15564-PA 260..513 42..302 213 24.4 Plus
Dper\GL26275-PA 880 GL26275-PA 384..659 35..302 197 27.1 Plus
Dper\GL26275-PA 880 GL26275-PA 89..277 98..300 155 26.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 04:56:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21909-PA 385 GA21909-PA 1..382 1..398 1376 65.4 Plus
Dpse\GA28526-PA 464 GA28526-PA 228..424 28..236 244 34.6 Plus
Dpse\GA20315-PA 709 GA20315-PA 178..459 18..302 229 25 Plus
Dpse\GA23061-PA 507 GA23061-PA 152..456 27..372 226 25.3 Plus
Dpse\GA10210-PA 868 GA10210-PA 269..522 42..302 213 24.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 04:56:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13367-PA 403 GM13367-PA 1..403 1..403 1975 95 Plus
Dsec\GM13856-PA 863 GM13856-PA 274..551 42..331 212 24.4 Plus
Dsec\GM14770-PA 676 GM14770-PA 199..456 36..302 200 24.9 Plus
Dsec\GM10968-PA 929 GM10968-PA 493..700 27..241 200 30.9 Plus
Dsec\GM11438-PA 887 GM11438-PA 481..733 42..304 194 28.1 Plus
Dsec\GM10968-PA 929 GM10968-PA 450..700 42..309 175 29.2 Plus
Dsec\GM10968-PA 929 GM10968-PA 305..639 35..309 154 24.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 04:56:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15724-PA 403 GD15724-PA 1..403 1..403 1969 94.8 Plus
Dsim\GD16713-PA 523 GD16713-PA 134..405 38..327 225 27.6 Plus
Dsim\GD13140-PA 863 GD13140-PA 274..551 42..331 212 24.4 Plus
Dsim\GD13947-PA 682 GD13947-PA 199..456 36..302 211 26 Plus
Dsim\GD22157-PA 782 GD22157-PA 341..548 27..241 201 31.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 04:56:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18817-PA 406 GJ18817-PA 1..403 1..401 1296 60.6 Plus
Dvir\GJ13362-PA 663 GJ13362-PA 99..389 9..302 234 24.9 Plus
Dvir\GJ16768-PA 522 GJ16768-PA 163..406 27..322 227 27.9 Plus
Dvir\GJ12011-PA 865 GJ12011-PA 224..521 1..302 213 22.6 Plus
Dvir\GJ16305-PA 405 GJ16305-PA 213..397 40..234 202 31.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 04:56:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18401-PA 385 GK18401-PA 1..384 1..396 1272 61.4 Plus
Dwil\GK16929-PA 751 GK16929-PA 225..482 38..302 242 26.8 Plus
Dwil\GK25316-PA 531 GK25316-PA 170..416 27..325 228 28 Plus
Dwil\GK16909-PA 893 GK16909-PA 286..563 42..331 221 25.4 Plus
Dwil\GK16907-PA 784 GK16907-PA 265..561 42..354 218 24.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 04:56:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15643-PA 403 GE15643-PA 2..403 3..403 1900 90.3 Plus
Dyak\GE21551-PA 708 GE21551-PA 200..457 38..302 230 25.9 Plus
Dyak\GE16375-PA 511 GE16375-PA 131..443 38..366 223 26.2 Plus
Dyak\GE26193-PA 537 GE26193-PA 86..330 35..304 221 30.3 Plus
Dyak\GE18294-PA 346 GE18294-PA 157..345 42..241 213 34.3 Plus
Dyak\GE26193-PA 537 GE26193-PA 246..498 27..303 152 28 Plus

LD35155.hyp Sequence

Translation from 228 to 1439

> LD35155.hyp
MPPGTQIASDSDMETALEEFKQRQGRRNSIGSAKYACSMPKCEATFKRLD
QLDRHEYHHTGIKKHACSYEGCDKTYSIVTHLKRHLRSTHERPESAAKKT
VKCALEECSKMFISVSNMTRHMRETHESPKVYPCSQCSAKFSQKLKLKRH
EIREHTLEYPYSCSKCSRGFYQQWQCQSHEPSCKLYECPGCPLQFDKWTL
YTKHCRDSLHGKNRHKCDRCDSAFDKPSELKRHLEVKHKEAAQTDECATS
FTCNEEGCGKSYSYLRNLRQHMLTAHSGRRFECQALDCGRCFSSAQNLAR
HLLRDHKDGATKKELKAKKKDKSKTGEGGKTKSTSRKRRRDAGRSKHSRL
SKLACLQLDKEDDEAVRERQPLVLEKITQSLKDDPVEELLAQTLQDEEEK
EQE*

LD35155.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:42:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG9609-PA 403 CG9609-PA 1..403 1..403 2185 100 Plus
CG32772-PE 520 CG32772-PE 132..403 38..327 279 27.4 Plus
CG32772-PC 520 CG32772-PC 132..403 38..327 279 27.4 Plus
crol-PG 878 CG14938-PG 293..583 22..309 277 29.2 Plus
CG5245-PA 501 CG5245-PA 49..322 4..306 273 26.5 Plus
CG5245-PA 501 CG5245-PA 198..463 42..302 224 27.4 Plus
CG5245-PA 501 CG5245-PA 331..491 34..234 181 26.9 Plus
CG5245-PA 501 CG5245-PA 356..490 31..179 166 31.5 Plus
CG5245-PA 501 CG5245-PA 367..490 18..150 156 35.5 Plus