Clone LD35711 Report

Search the DGRC for LD35711

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:357
Well:11
Vector:pOT2
Associated Gene/TranscriptArp3-RA
Protein status:LD35711.pep: gold
Preliminary Size:1929
Sequenced Size:1584

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7558 2001-01-01 Release 2 assignment
CG7558 2001-07-04 Blastp of sequenced clone
CG7558 2003-01-01 Sim4 clustering to Release 3
Arp66B 2008-04-29 Release 5.5 accounting
Arp66B 2008-08-15 Release 5.9 accounting
Arp66B 2008-12-18 5.12 accounting

Clone Sequence Records

LD35711.complete Sequence

1584 bp (1584 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051859

> LD35711.complete
TGACACATAGTTGGAGGTGTGGTTGAAAATATATAGAAATCTGGGTTTAT
CTGCAACTGAAACGAAGGGAAATTTGTGTTAAAGGCGAGCGAAGATCGCA
ACTGAAGAGCTTTAACTGGCAGCAAGGCAAAAGGACGAGCAGCGACCATG
GCAGGCAGGCTACCGGCATGCGTAATCGATGTGGGCACCGGCTACTCCAA
ACTGGGATTTGCCGGGAATAAAGAGCCGCAGTTCATTATTCCCTCGGCGA
TTGCCATCAAGGAGTCGGCACGAGTGGGAGACACCAACACACGGCGCATC
ACAAAGGGCATCGAGGACCTGGACTTCTTCATCGGCGATGAGGCCTTCGA
TGCCACCGGCTACTCCATCAAGTATCCGGTGCGTCATGGTCTGGTGGAGG
ACTGGGACTTGATGGAGCGCTTTCTGGAGCAGTGCGTCTTTAAGTATCTG
CGCGCCGAGCCTGAGGATCACTACTTCCTGCTGACTGAGCCGCCGCTAAA
TACGCCCGAAAATCGGGAGTACACCGCGGAGATAATGTTTGAGACGTTCA
ACGTTCCTGGTCTGTATATCGCCGTCCAGGCGGTGCTTGCCCTAGCCGCC
AGTTGGGCCTCCCGGTCCGCAGAGGAGCGTACCCTTACAGGCATCGTGGT
GGACAGCGGCGATGGAGTGACGCACGTCATACCCGTGGCCGAGGGCTATG
TGATCGGCTCCTGCATCAAGCACATTCCCATCGCGGGCCGCAATATCACC
TCGTTCATCCAGAGCCTGCTACGCGAACGGGAGGTGGGCATTCCGCCGGA
ACAGAGCCTCGAGACTGCTAAAGCGATCAAGGAGAAGCACTGCTACATCT
GTCCCGATATCGCCAAAGAATTTGCCAAGTACGACACGGAGCCGGGCAAG
TGGATACGCAACTTTAGCGGCGTTAACACGGTAACCAAGGCGCCGTTCAA
TGTGGACGTGGGCTACGAGCGATTCCTGGGACCCGAGATCTTCTTCCATC
CCGAGTTCTCAAACCCCGACTTTACCATTCCACTGTCGGAAATAGTGGAT
AATGTCATCCAAAACTGCCCAATCGATGTGCGGCGTCCTCTATACAATAA
CATTGTTCTGAGCGGTGGATCAACGATGTTCAAGGACTTCGGCAGGAGGT
TGCAGCGAGATATCAAGCGATCGGTGGACACACGTCTCCGGATCAGCGAG
AATTTGTCCGAGGGACGCATTAAGCCAAAACCCATTGATGTTCAGGTGAT
TACGCACCACATGCAGAGGTACGCCGTGTGGTTTGGAGGCAGCATGTTGG
CTTCAACGCCCGAGTTCTATCAGGTGTGTCACACGAAGGCTGCCTACGAG
GAGTATGGCCCCAGCATTTGCCGTCACAATCCCGTCTTTGGCACCATGAC
ATAATTGATCCGATCCAATCGGCTTGCAGCAGTTATTTTTGATTTATTTT
TCCATTTAAAATTGATTTATTGATTTATTCTCCAACTATATATATATATA
TATACATTGCGATTCGGTATTCCACGCTAAAGTATTAGTAATTATTCTTT
TCTATAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

LD35711.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:30:08
Subject Length Description Subject Range Query Range Score Percent Strand
Arp66B-RA 2111 Arp66B-RA 124..1679 1..1556 7780 100 Plus
Arp66B.b 1953 Arp66B.b 164..1637 83..1556 7370 100 Plus
Arp66B.a 1863 Arp66B.a 74..1547 83..1556 7370 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 23:53:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8106305..8106842 1224..687 2690 100 Minus
chr3L 24539361 chr3L 8107077..8107394 688..371 1590 100 Minus
chr3L 24539361 chr3L 8105853..8106100 1555..1308 1240 100 Minus
chr3L 24539361 chr3L 8107730..8107920 191..1 955 100 Minus
chr3L 24539361 chr3L 8107456..8107637 372..191 910 100 Minus
chr3L 24539361 chr3L 8106161..8106246 1308..1223 430 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 23:53:33
Subject Length Description Subject Range Query Range Score Percent Strand
Arp3-RB 1257 CG7558-PB 1..1257 148..1404 6285 100 Plus
Arp3-RA 1257 CG7558-PA 1..1257 148..1404 6285 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:30:15 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:53:31
Subject Length Description Subject Range Query Range Score Percent Strand
Arp3-RB 1585 CG7558-RB 31..1585 1..1555 7775 100 Plus
Arp3-RA 1983 CG7558-RA 31..1585 1..1555 7775 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:53:35
Subject Length Description Subject Range Query Range Score Percent Strand
Arp3-PB 418 CG7558-PB 1..418 148..1401 2099 100 Plus
Arp3-PA 418 CG7558-PA 1..418 148..1401 2099 100 Plus
Act87E-PC 376 CG18290-PC 8..370 166..1368 601 34.1 Plus
Act87E-PB 376 CG18290-PB 8..370 166..1368 601 34.1 Plus
Act87E-PA 376 CG18290-PA 8..370 166..1368 601 34.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 23:53:28
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8114257..8114794 1224..687 2690 100 Minus
3L 28110227 3L 8115029..8115346 688..371 1590 100 Minus
3L 28110227 3L 8113804..8114052 1556..1308 1245 100 Minus
3L 28110227 3L 8115682..8115872 191..1 955 100 Minus
3L 28110227 3L 8115408..8115589 372..191 910 100 Minus
3L 28110227 3L 8114113..8114198 1308..1223 430 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:52:24
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8107357..8107894 1224..687 2690 100 Minus
3L 28103327 3L 8108129..8108446 688..371 1590 100 Minus
3L 28103327 3L 8106904..8107152 1556..1308 1245 100 Minus
3L 28103327 3L 8108782..8108972 191..1 955 100 Minus
3L 28103327 3L 8108508..8108689 372..191 910 100 Minus
3L 28103327 3L 8107213..8107298 1308..1223 430 100 Minus
Blast to na_te.dros performed on 2014-11-26 23:53:30 has no hits.

LD35711.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:24:03 Download gff for LD35711.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8107730..8107920 1..191 100   Minus
chr3L 8107456..8107636 192..372 100 <- Minus
chr3L 8107078..8107392 373..687 100 <- Minus
chr3L 8106305..8106841 688..1224 100 <- Minus
chr3L 8106161..8106244 1225..1308 100 <- Minus
chr3L 8105853..8106099 1309..1555 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:17:53 Download gff for LD35711.complete
Subject Subject Range Query Range Percent Splice Strand
Arp66B-RA 1..1257 148..1404 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:18:10 Download gff for LD35711.complete
Subject Subject Range Query Range Percent Splice Strand
Arp66B-RA 1..1257 148..1404 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:21:16 Download gff for LD35711.complete
Subject Subject Range Query Range Percent Splice Strand
Arp3-RA 1..1257 148..1404 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:49:44 Download gff for LD35711.complete
Subject Subject Range Query Range Percent Splice Strand
Arp66B-RA 1..1257 148..1404 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:24:03 Download gff for LD35711.complete
Subject Subject Range Query Range Percent Splice Strand
Arp3-RA 1..1257 148..1404 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:13:16 Download gff for LD35711.complete
Subject Subject Range Query Range Percent Splice Strand
Arp66B-RA 29..1583 1..1555 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:18:10 Download gff for LD35711.complete
Subject Subject Range Query Range Percent Splice Strand
Arp66B-RA 29..1583 1..1555 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:21:16 Download gff for LD35711.complete
Subject Subject Range Query Range Percent Splice Strand
Arp3-RA 31..1585 1..1555 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:49:44 Download gff for LD35711.complete
Subject Subject Range Query Range Percent Splice Strand
Arp66B-RA 29..1583 1..1555 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:24:03 Download gff for LD35711.complete
Subject Subject Range Query Range Percent Splice Strand
Arp3-RA 31..1585 1..1555 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:24:03 Download gff for LD35711.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8115682..8115872 1..191 100   Minus
3L 8115408..8115588 192..372 100 <- Minus
3L 8115030..8115344 373..687 100 <- Minus
3L 8114257..8114793 688..1224 100 <- Minus
3L 8114113..8114196 1225..1308 100 <- Minus
3L 8113805..8114051 1309..1555 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:21:16 Download gff for LD35711.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8108782..8108972 1..191 100   Minus
arm_3L 8108508..8108688 192..372 100 <- Minus
arm_3L 8108130..8108444 373..687 100 <- Minus
arm_3L 8107357..8107893 688..1224 100 <- Minus
arm_3L 8107213..8107296 1225..1308 100 <- Minus
arm_3L 8106905..8107151 1309..1555 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:27:56 Download gff for LD35711.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8108782..8108972 1..191 100   Minus
3L 8108508..8108688 192..372 100 <- Minus
3L 8108130..8108444 373..687 100 <- Minus
3L 8107357..8107893 688..1224 100 <- Minus
3L 8107213..8107296 1225..1308 100 <- Minus
3L 8106905..8107151 1309..1555 100 <- Minus

LD35711.pep Sequence

Translation from 147 to 1403

> LD35711.pep
MAGRLPACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRR
ITKGIEDLDFFIGDEAFDATGYSIKYPVRHGLVEDWDLMERFLEQCVFKY
LRAEPEDHYFLLTEPPLNTPENREYTAEIMFETFNVPGLYIAVQAVLALA
ASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRNI
TSFIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAKEFAKYDTEPG
KWIRNFSGVNTVTKAPFNVDVGYERFLGPEIFFHPEFSNPDFTIPLSEIV
DNVIQNCPIDVRRPLYNNIVLSGGSTMFKDFGRRLQRDIKRSVDTRLRIS
ENLSEGRIKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKAAY
EEYGPSICRHNPVFGTMT*

LD35711.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 04:46:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10484-PA 418 GF10484-PA 1..418 1..418 2231 99.3 Plus
Dana\GF17602-PA 376 GF17602-PA 6..376 5..414 664 35.5 Plus
Dana\GF12208-PA 376 GF12208-PA 6..376 5..414 662 35.5 Plus
Dana\GF13827-PA 376 GF13827-PA 6..376 5..414 661 35.8 Plus
Dana\GF18300-PA 376 GF18300-PA 8..376 7..414 656 35.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 04:46:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14922-PA 418 GG14922-PA 1..418 1..418 2239 99.8 Plus
Dere\GG19688-PA 376 GG19688-PA 6..376 5..414 664 35.5 Plus
Dere\GG22068-PA 376 GG22068-PA 6..376 5..414 662 35.5 Plus
Dere\GG18797-PA 376 GG18797-PA 6..376 5..414 662 36.1 Plus
Dere\GG10840-PA 376 GG10840-PA 6..376 5..414 659 35.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 04:46:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15291-PA 418 GH15291-PA 1..418 1..418 2133 96.9 Plus
Dgri\GH19045-PA 376 GH19045-PA 6..376 5..414 664 35.5 Plus
Dgri\GH22007-PA 376 GH22007-PA 6..376 5..414 662 35.5 Plus
Dgri\GH24372-PA 376 GH24372-PA 6..376 5..414 662 36.1 Plus
Dgri\GH20408-PA 376 GH20408-PA 6..376 5..414 660 35.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 04:46:14
Subject Length Description Subject Range Query Range Score Percent Strand
Arp3-PB 418 CG7558-PB 1..418 1..418 2211 100 Plus
Arp3-PA 418 CG7558-PA 1..418 1..418 2211 100 Plus
Act87E-PC 376 CG18290-PC 8..370 7..407 648 35.8 Plus
Act87E-PB 376 CG18290-PB 8..370 7..407 648 35.8 Plus
Act87E-PA 376 CG18290-PA 8..370 7..407 648 35.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 04:46:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12000-PA 418 GI12000-PA 1..418 1..418 2134 97.1 Plus
Dmoj\GI24339-PA 376 GI24339-PA 6..376 5..414 664 35.5 Plus
Dmoj\GI19595-PA 376 GI19595-PA 6..376 5..414 663 36.1 Plus
Dmoj\GI19711-PA 376 GI19711-PA 6..376 5..414 662 35.5 Plus
Dmoj\GI15312-PA 376 GI15312-PA 6..376 5..414 662 36.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 04:46:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22484-PA 418 GL22484-PA 1..418 1..418 2223 98.6 Plus
Dper\GL26327-PA 376 GL26327-PA 8..376 7..414 667 36.5 Plus
Dper\GL17061-PA 376 GL17061-PA 6..376 5..414 662 35.5 Plus
Dper\GL14888-PA 376 GL14888-PA 6..376 5..414 662 36.1 Plus
Dper\GL17787-PA 376 GL17787-PA 6..376 5..414 660 35.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 04:46:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20439-PA 418 GA20439-PA 1..418 1..418 2223 98.6 Plus
Dpse\GA14877-PB 376 GA14877-PB 6..376 5..414 664 35.5 Plus
Dpse\GA14877-PA 376 GA14877-PA 6..376 5..414 664 35.5 Plus
Dpse\GA24346-PA 376 GA24346-PA 6..376 5..414 662 35.5 Plus
Dpse\GA17886-PA 376 GA17886-PA 6..376 5..414 662 36.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 04:46:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24973-PA 418 GM24973-PA 1..418 1..418 2242 100 Plus
Dsec\GM12447-PA 376 GM12447-PA 6..376 5..414 662 36.1 Plus
Dsec\GM16492-PA 376 GM16492-PA 6..376 5..414 659 35.8 Plus
Dsec\GM22426-PA 376 GM22426-PA 8..376 7..414 654 35.7 Plus
Dsec\GM24109-PA 376 GM24109-PA 6..376 5..414 644 35.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 04:46:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17591-PA 180 GD17591-PA 1..179 1..179 947 100 Plus
Dsim\GD18909-PA 376 GD18909-PA 6..376 5..414 664 35.5 Plus
Dsim\GD11548-PA 376 GD11548-PA 6..376 5..414 662 35.5 Plus
Dsim\GD16764-PA 376 GD16764-PA 6..376 5..414 662 36.1 Plus
Dsim\GD10342-PA 376 GD10342-PA 6..376 5..414 659 35.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 04:46:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13271-PA 418 GJ13271-PA 1..418 1..418 2123 96.7 Plus
Dvir\ActE1-PA 376 GJ10425-PA 6..376 5..414 664 35.5 Plus
Dvir\GJ18395-PA 376 GJ18395-PA 6..376 5..414 663 36.1 Plus
Dvir\ActC2-PA 376 GJ17479-PA 6..376 5..414 662 35.5 Plus
Dvir\GJ14747-PA 376 GJ14747-PA 6..376 5..414 662 36.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 04:46:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19880-PA 417 GK19880-PA 1..417 1..418 2103 96.4 Plus
Dwil\GK13943-PA 376 GK13943-PA 6..376 5..414 664 35.5 Plus
Dwil\GK23336-PA 376 GK23336-PA 6..376 5..414 662 35.5 Plus
Dwil\GK20124-PA 376 GK20124-PA 6..376 5..414 662 36.1 Plus
Dwil\GK21751-PA 376 GK21751-PA 6..376 5..414 659 35.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 04:46:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20375-PA 418 GE20375-PA 1..418 1..418 2239 99.8 Plus
Dyak\GE26273-PA 376 GE26273-PA 6..376 5..414 664 35.5 Plus
Dyak\GE12149-PA 376 GE12149-PA 6..376 5..414 662 35.5 Plus
Dyak\Act57B-PA 376 GE17558-PA 6..376 5..414 662 36.1 Plus
Dyak\GE19434-PA 376 GE19434-PA 6..376 5..414 659 35.8 Plus

LD35711.hyp Sequence

Translation from 147 to 1403

> LD35711.hyp
MAGRLPACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRR
ITKGIEDLDFFIGDEAFDATGYSIKYPVRHGLVEDWDLMERFLEQCVFKY
LRAEPEDHYFLLTEPPLNTPENREYTAEIMFETFNVPGLYIAVQAVLALA
ASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRNI
TSFIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAKEFAKYDTEPG
KWIRNFSGVNTVTKAPFNVDVGYERFLGPEIFFHPEFSNPDFTIPLSEIV
DNVIQNCPIDVRRPLYNNIVLSGGSTMFKDFGRRLQRDIKRSVDTRLRIS
ENLSEGRIKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKAAY
EEYGPSICRHNPVFGTMT*

LD35711.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:50:12
Subject Length Description Subject Range Query Range Score Percent Strand
Arp3-PB 418 CG7558-PB 1..418 1..418 2211 100 Plus
Arp3-PA 418 CG7558-PA 1..418 1..418 2211 100 Plus
Act87E-PC 376 CG18290-PC 8..370 7..407 648 35.8 Plus
Act87E-PB 376 CG18290-PB 8..370 7..407 648 35.8 Plus
Act87E-PA 376 CG18290-PA 8..370 7..407 648 35.8 Plus