Clone LD36265 Report

Search the DGRC for LD36265

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:362
Well:65
Vector:pOT2
Associated Gene/TranscriptUGP-RD
Protein status:LD36265.pep: gold
Preliminary Size:1983
Sequenced Size:2026

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
UGP-RC 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

LD36265.complete Sequence

2026 bp assembled on 2011-01-03

GenBank Submission: BT125863.1

> LD36265.complete
AGAAGCGGATAATAATCTTGAGAGAATCAATTTAATTTTACACTAAAAGT
TGCGGGTGTAAAAAAGTTTCAGTGTGGTTTCTCATTCTCTTTGCTTTCAA
TTTGTGTGTGTGTGTGCAGCAAAACAACTAAATTAGTGACGCTTAATTGC
TAAATTACTCAAGTGTTAAATTTACTTTACTTCAAAATGCTGGATGTTCC
ACATGAAGCTAAGGTGCGCGGCCACCAGCGTGCACCGTCCGACTCCAAGG
AGTTCCATGAGGTGACCAAACGGGATGCACTTCGTCTGCTGGAGCACGAT
GTGGACCGTCTGCTGGAGACCACTGAGAAGGCCCGCCAGCCTGCCCTCAA
GGCAGAAATGGGTCGTTTCGCCGATCTGTTCGGACGTTTCATTCAGGAAG
AGGGTCCCGCATTGGACTGGAACAAGATTCAGAAGCTGCCTGAGAATGCT
GTGATGAACTACTCGAATCTTAAGTCGCCCAAGAACGAGCAGATCCGCAA
CATGTTGGATAAATTGGTGGTCATCAAGCTGAACGGTGGTTTGGGCACCT
CAATGGGTTGCCATGGTCCCAAGAGTGTGATTCCTGTGCGTTCGGATCTT
ACTTTCCTGGATCTGACCGTGCAGCAAATCGAGCATCTCAACAAGACCTA
CGATGCCAATGTTCCGCTGGTACTGATGAACTCCTTTAACACCGACGAGG
ATACCGAGAAGATCGTGCGCAAGTACAAAGGATTCCGTGTGCAGATCCAC
ACCTTCAACCAGAGCTGCTTCCCGCGCATTAGTCGCGAGCACTACCTGCC
GGTGGCCAAAGACTTTGATGTCGAAAAGGATATGGAAGCCTGGTATCCAC
CTGGACACGGTGACTTCTACGATACCTTCCGCAACTCTGGCCTGCTGAAG
AAGTTCATCGAGGAGGGCCGCGAGTATTGTTTCTTGTCCAACATCGATAA
CCTGGGCGCCACCGTCGATCTGAACATCCTCAATAAGCTGGTGGGCGAGG
AGCGGGCCACTACTCCAGTGGAGTTTGTCATGGAGGTCACCGACAAGACC
CGTGCTGACGTTAAGGGTGGTACTCTCATTCAAATGGAAAACAAGCTGCG
CCTGTTGGAAATTGCTCAAGTGCCACCAGAGCATGTGGATGACTTTAAGT
CGGTTAAGACCTTCAAGTTCTTTAACACCAACAACATTTGGGCCAACCTG
GCAGCCATTGATCGCGTTTTGCGTGAGCGTACCTTAAACATGGAAATTAT
TGTGAACAACAAGACGCTGGAGAACGGAACCCGTGTCATTCAGCTGGAGA
CTGCTGTGGGTGCGGCCATGAAGTGCTTTGATGGCGCCATCGGCATCAAT
GTGCCGCGTTCCCGTTTCTTGCCCGTGAAGAAATCTTCAGATCTGCTGCT
GGTCATGTCAAATTTATATACGCTTAAGAACGGCAGCCTGGTAATGTCGC
CACAGCGAATGTTCCCTACCACGCCGCTCGTCAAGCTGGGAGAGAACCAC
TTCTCGAAGGTCAAGGAGTTCCTGGGTCGCTTTGCCAACATCCCGGACAT
CATTGAGCTGGATCACTTGACCGTGAGCGGAGATGTGACTTTCGGTCGTG
GCGTTTCTTTGCGCGGCACTGTGATCATCATTGCTAACCATGGCGATCGT
ATCGATATCCCAGCTGGAGCCATTCTGGAGAACAAGATTGTATCTGGCAA
TATGCGCATCTTGGACCACTAAATCAAATCCTGTACAATTGGATATCGTC
TCACTAACTGTAGTCTAATTGTCTAAGTTTTATGTAGTAGCCATGTTCGC
GTTTCAAATTTCCAATAACGAATTTCATTTAGCCAATTGTTGTAAGCACA
AAGTGTGTCATCTGTATATATCGTTAAGTAGAAATCAGTCAGGGTTTTTA
ATCAAAATCGAATTGCAATATGTTTTCAAAAATGTTAGTTGTAGTCGTTC
AAATGAGATATAAAAGATAGCAGCTGTTGAAACTCAATAAAGGCATGTTT
ATTTCTATAAAAAAAAAAAAAAAAAA

LD36265.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:41:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9343846..9344258 1615..1203 2050 99.8 Minus
chr3L 24539361 chr3L 9343386..9343779 2008..1615 1940 99.5 Minus
chr3L 24539361 chr3L 9344811..9345159 839..491 1745 100 Minus
chr3L 24539361 chr3L 9344530..9344756 1066..840 1135 100 Minus
chr3L 24539361 chr3L 9350526..9350741 216..1 1065 99.5 Minus
chr3L 24539361 chr3L 9345817..9346005 400..212 915 98.9 Minus
chr3L 24539361 chr3L 9344334..9344474 1204..1064 705 100 Minus
chr3L 24539361 chr3L 9345667..9345760 492..399 470 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:41:46
Subject Length Description Subject Range Query Range Score Percent Strand
UGP-RD 1536 CG4347-PD 1..1536 187..1722 7680 100 Plus
UGP-RC 1542 CG4347-PC 1..1542 187..1722 7585 99.6 Plus
UGP-RE 1557 CG4347-PE 49..1557 214..1722 7545 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:41:45
Subject Length Description Subject Range Query Range Score Percent Strand
UGP-RD 2093 CG4347-RD 109..2093 1..1985 9925 100 Plus
UGP-RC 2099 CG4347-RC 109..2099 1..1985 9830 99.7 Plus
UGP-RE 2686 CG4347-RE 302..2096 214..2008 8975 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:41:48
Subject Length Description Subject Range Query Range Score Percent Strand
UGP-PD 511 CG4347-PD 1..511 187..1719 2643 100 Plus
UGP-PC 513 CG4347-PC 1..513 187..1719 2630 99.6 Plus
UGP-PE 518 CG4347-PE 15..518 208..1719 2597 99.8 Plus
UGP-PA 520 CG4347-PA 15..520 208..1719 2584 99.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:41:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9351917..9352329 1615..1203 2065 100 Minus
3L 28110227 3L 9351454..9351850 2011..1615 1985 100 Minus
3L 28110227 3L 9352882..9353230 839..491 1745 100 Minus
3L 28110227 3L 9352601..9352827 1066..840 1135 100 Minus
3L 28110227 3L 9358612..9358827 216..1 1080 100 Minus
3L 28110227 3L 9353888..9354076 400..212 945 100 Minus
3L 28110227 3L 9352405..9352545 1204..1064 705 100 Minus
3L 28110227 3L 9353738..9353831 492..399 470 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:04:22
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 9345017..9345429 1615..1203 2065 100 Minus
3L 28103327 3L 9344554..9344950 2011..1615 1985 100 Minus
3L 28103327 3L 9345982..9346330 839..491 1745 100 Minus
3L 28103327 3L 9345701..9345927 1066..840 1135 100 Minus
3L 28103327 3L 9351712..9351927 216..1 1080 100 Minus
3L 28103327 3L 9346988..9347176 400..212 945 100 Minus
3L 28103327 3L 9345505..9345645 1204..1064 705 100 Minus
3L 28103327 3L 9346838..9346931 492..399 470 100 Minus
Blast to na_te.dros performed 2014-11-27 16:41:44
Subject Length Description Subject Range Query Range Score Percent Strand
copia 5143 copia DMCOPIA 5143bp Derived from X02599 (g7740) (Rel. 49, Last updated, Version 4). 50..101 1964..1913 116 69.2 Minus
copia 5143 copia DMCOPIA 5143bp Derived from X02599 (g7740) (Rel. 49, Last updated, Version 4). 4919..4970 1964..1913 116 69.2 Minus

LD36265.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:56:28 Download gff for LD36265.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9350529..9350741 1..213 99   Minus
chr3L 9345817..9346003 214..400 98 <- Minus
chr3L 9345667..9345758 401..492 100 <- Minus
chr3L 9344811..9345157 493..839 100 <- Minus
chr3L 9344531..9344756 840..1065 100 <- Minus
chr3L 9344334..9344472 1066..1204 100 <- Minus
chr3L 9343847..9344256 1205..1614 99 <- Minus
chr3L 9343386..9343779 1615..2008 99 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-01-05 09:01:00 Download gff for LD36265.complete
Subject Subject Range Query Range Percent Splice Strand
UGP-RD 1..1536 187..1722 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:37:16 Download gff for LD36265.complete
Subject Subject Range Query Range Percent Splice Strand
UGP-RD 1..1536 187..1722 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:56:28 Download gff for LD36265.complete
Subject Subject Range Query Range Percent Splice Strand
UGP-RD 1..1536 187..1722 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-05 09:01:00 Download gff for LD36265.complete
Subject Subject Range Query Range Percent Splice Strand
UGP-RD 105..2089 1..1985 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:37:16 Download gff for LD36265.complete
Subject Subject Range Query Range Percent Splice Strand
UGP-RD 109..2093 1..1985 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:56:28 Download gff for LD36265.complete
Subject Subject Range Query Range Percent Splice Strand
UGP-RD 109..2093 1..1985 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:56:28 Download gff for LD36265.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9358615..9358827 1..213 100   Minus
3L 9353888..9354074 214..400 100 <- Minus
3L 9353738..9353829 401..492 100 <- Minus
3L 9352882..9353228 493..839 100 <- Minus
3L 9352602..9352827 840..1065 100 <- Minus
3L 9352405..9352543 1066..1204 100 <- Minus
3L 9351918..9352327 1205..1614 100 <- Minus
3L 9351457..9351850 1615..2008 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:37:16 Download gff for LD36265.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9351715..9351927 1..213 100   Minus
arm_3L 9346988..9347174 214..400 100 <- Minus
arm_3L 9346838..9346929 401..492 100 <- Minus
arm_3L 9345982..9346328 493..839 100 <- Minus
arm_3L 9345702..9345927 840..1065 100 <- Minus
arm_3L 9345505..9345643 1066..1204 100 <- Minus
arm_3L 9345018..9345427 1205..1614 100 <- Minus
arm_3L 9344557..9344950 1615..2008 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:53:31 Download gff for LD36265.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9351715..9351927 1..213 100   Minus
3L 9346988..9347174 214..400 100 <- Minus
3L 9346838..9346929 401..492 100 <- Minus
3L 9345982..9346328 493..839 100 <- Minus
3L 9345702..9345927 840..1065 100 <- Minus
3L 9345505..9345643 1066..1204 100 <- Minus
3L 9345018..9345427 1205..1614 100 <- Minus
3L 9344557..9344950 1615..2008 100 <- Minus

LD36265.pep Sequence

Translation from 186 to 1721

> LD36265.pep
MLDVPHEAKVRGHQRAPSDSKEFHEVTKRDALRLLEHDVDRLLETTEKAR
QPALKAEMGRFADLFGRFIQEEGPALDWNKIQKLPENAVMNYSNLKSPKN
EQIRNMLDKLVVIKLNGGLGTSMGCHGPKSVIPVRSDLTFLDLTVQQIEH
LNKTYDANVPLVLMNSFNTDEDTEKIVRKYKGFRVQIHTFNQSCFPRISR
EHYLPVAKDFDVEKDMEAWYPPGHGDFYDTFRNSGLLKKFIEEGREYCFL
SNIDNLGATVDLNILNKLVGEERATTPVEFVMEVTDKTRADVKGGTLIQM
ENKLRLLEIAQVPPEHVDDFKSVKTFKFFNTNNIWANLAAIDRVLRERTL
NMEIIVNNKTLENGTRVIQLETAVGAAMKCFDGAIGINVPRSRFLPVKKS
SDLLLVMSNLYTLKNGSLVMSPQRMFPTTPLVKLGENHFSKVKEFLGRFA
NIPDIIELDHLTVSGDVTFGRGVSLRGTVIIIANHGDRIDIPAGAILENK
IVSGNMRILDH*

LD36265.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 12:10:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23744-PA 529 GF23744-PA 1..529 1..511 2635 94.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 12:10:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14051-PA 513 GG14051-PA 1..513 1..511 2694 98.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 12:10:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16268-PA 511 GH16268-PA 1..511 1..511 2627 96.1 Plus
Dgri\GH22478-PA 493 GH22478-PA 13..493 6..511 2423 90.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:10:21
Subject Length Description Subject Range Query Range Score Percent Strand
UGP-PD 511 CG4347-PD 1..511 1..511 2643 100 Plus
UGP-PC 513 CG4347-PC 1..513 1..511 2630 99.6 Plus
UGP-PE 518 CG4347-PE 15..518 8..511 2597 99.8 Plus
UGP-PA 520 CG4347-PA 15..520 8..511 2584 99.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 12:10:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13203-PA 520 GI13203-PA 13..520 6..511 2594 95.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 12:10:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18418-PA 513 GL18418-PA 1..513 1..511 2624 95.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 12:10:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18125-PA 513 GA18125-PA 1..513 1..511 2624 95.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 12:10:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24885-PA 513 GM24885-PA 1..513 1..511 2711 99.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 12:10:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12937-PA 531 GD12937-PA 1..531 1..511 2678 96.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 12:10:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11980-PA 529 GJ11980-PA 1..529 1..511 2618 94 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 12:10:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24300-PA 513 GK24300-PA 1..513 1..511 2614 95.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 12:10:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21254-PA 520 GE21254-PA 15..520 8..511 2661 99.2 Plus

LD36265.hyp Sequence

Translation from 186 to 1721

> LD36265.hyp
MLDVPHEAKVRGHQRAPSDSKEFHEVTKRDALRLLEHDVDRLLETTEKAR
QPALKAEMGRFADLFGRFIQEEGPALDWNKIQKLPENAVMNYSNLKSPKN
EQIRNMLDKLVVIKLNGGLGTSMGCHGPKSVIPVRSDLTFLDLTVQQIEH
LNKTYDANVPLVLMNSFNTDEDTEKIVRKYKGFRVQIHTFNQSCFPRISR
EHYLPVAKDFDVEKDMEAWYPPGHGDFYDTFRNSGLLKKFIEEGREYCFL
SNIDNLGATVDLNILNKLVGEERATTPVEFVMEVTDKTRADVKGGTLIQM
ENKLRLLEIAQVPPEHVDDFKSVKTFKFFNTNNIWANLAAIDRVLRERTL
NMEIIVNNKTLENGTRVIQLETAVGAAMKCFDGAIGINVPRSRFLPVKKS
SDLLLVMSNLYTLKNGSLVMSPQRMFPTTPLVKLGENHFSKVKEFLGRFA
NIPDIIELDHLTVSGDVTFGRGVSLRGTVIIIANHGDRIDIPAGAILENK
IVSGNMRILDH*

LD36265.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:51:49
Subject Length Description Subject Range Query Range Score Percent Strand
UGP-PD 511 CG4347-PD 1..511 1..511 2643 100 Plus
UGP-PC 513 CG4347-PC 1..513 1..511 2630 99.6 Plus
UGP-PE 518 CG4347-PE 15..518 8..511 2597 99.8 Plus
UGP-PA 520 CG4347-PA 15..520 8..511 2584 99.4 Plus