Clone LD36528 Report

Search the DGRC for LD36528

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:365
Well:28
Vector:pOT2
Associated Gene/Transcriptsug-RA
Protein status:LD36528.pep: gold
Preliminary Size:1458
Sequenced Size:1342

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3850 2001-01-01 Release 2 assignment
CG3850 2001-11-29 Blastp of sequenced clone
CG3850 2003-01-01 Sim4 clustering to Release 3
sug 2008-04-29 Release 5.5 accounting
sug 2008-08-15 Release 5.9 accounting
sug 2008-12-18 5.12 accounting

Clone Sequence Records

LD36528.complete Sequence

1342 bp (1342 high quality bases) assembled on 2001-11-29

GenBank Submission: AY069605

> LD36528.complete
CTTTAGCGAAAGCAACAAATTTTCTCGATCAGCACCCACCACAGACAACA
AACATGGATATAATACAAAAGTCAATCTTCAACAGCGGCCCACACAGCAG
AGGCATCTACGAGCCGCCTCTCGGCTACTTTACGCCGTATAACACACCAC
CGTACATAGCCGCCTACTCGGATTCCGGCAGCTGGTTGGCGGATCACCAC
CAACACCACCAGCAGCAGCACCAGCAGCACCAGCAGCAGATGCAGCACAT
CAGGTTTCCCACGCCGCCCATCACACCGCCGCGTCCCATCGCCGGATACG
GATATCGTCAGCGCACCCAGTCCGTGATCATGAAGGCTCGTGGCCAGCAG
GACGAGCTCTGCCGCAGTCCAGTGGAGTTCCCCGACGACAGCAAGTCCTG
CAGCAGCAGCAGCGAGTGCGGCACCGCCAGCGATTTCGTATGCAACTGGA
CAGATTGCGATAGAGTTTTCGACACCTTGGATGCACTGGCACAGCACGTG
ACCCAGCGACATGCGATCGCCAGCCTGACAGACGGACTCTACTATTGCCG
CTGGCGGGGATGTCAGCGCAGCGAGCGAGGATTCAATGCCCGCTACAAGA
TGCTTGTCCATACCCGCACCCACACGAAGGAGAAGCCACATCGCTGTCAC
CTGTGCGAGAAGTCCTTCTCGCGGGCGGAGAACCTGAAGATCCACATTAG
GTCACACTCGGGCGAGAAACCCTACAAGTGCAGCTTCGAGGGCTGCCAGA
AGGCGTACTCGAACTCCTCGGATCGTTTCAAGCACACGCGCACCCATTCG
ATGGAGAAGCCGTACATGTGCAAAGTGGCCGGCTGCCAGAAGCGCTACAC
GGATCCGTCCTCGCTGCGAAAGCACGTCAAGACCTTCAAGCACAGCATCC
ACCTGATCGCCAGCCAGCCGCTCACTCTGCCCAGCGTACCCTGTCTCCTG
GAGGCCAGCAGCGAATCAGCGTTCACGTGTCTTCCCGCTGCCAGCAGTGT
GGAGTCCACCAGCTCCTCCTCATCCGCCCGCTACTACGATGACTCCAACA
ATGAGCCCAGCGATTACTCGCTAAAACCCAAACAGGATGCGGAATTCTCG
CCCAGCTATTGGCTAGGCGATAGACAGCATAGCTATCTCCACAGCGAGGA
CTTCTTCGTTAAGATGGACGTGGAGTCACCGCTCGACCTGCGCATCCATC
GAATCTGAACTGGCCAATCGGTTCGCCTCTCGTCTCTCTTCCCCTTCTAG
TCATTGCGCTGTTTCCCAGCTCTTGTCACCACACCTAGATTACTATTTAA
CGTGATTAAAGACTGTTGTAATTGAAAAAAAAAAAAAAAAAA

LD36528.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:55:40
Subject Length Description Subject Range Query Range Score Percent Strand
sugarbabe-RA 1342 sugarbabe-RA 17..1342 1..1326 6630 100 Plus
CG13319.b 1063 CG13319.b 713..1063 86..436 1755 100 Plus
nc_6439.a 112 nc_6439.a 29..112 84..167 420 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:15:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8817107..8817969 462..1324 4315 100 Plus
chr2R 21145070 chr2R 8816204..8816666 1..463 2315 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:15:47
Subject Length Description Subject Range Query Range Score Percent Strand
sug-RA 1155 CG3850-PA 1..1155 54..1208 5775 100 Plus
sug-RB 969 CG3850-PB 1..969 240..1208 4845 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:31:23 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:15:46
Subject Length Description Subject Range Query Range Score Percent Strand
sug-RA 1343 CG3850-RA 20..1343 1..1324 6620 100 Plus
sug-RB 1468 CG3850-RB 228..1468 84..1324 6205 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:15:49
Subject Length Description Subject Range Query Range Score Percent Strand
sug-PA 384 CG3850-PA 1..384 54..1205 1764 100 Plus
sug-PB 322 CG3850-PB 18..322 291..1205 1535 100 Plus
ci-PB 1279 CG2125-PB 329..483 432..884 461 54.8 Plus
ci-PA 1397 CG2125-PA 447..601 432..884 461 54.8 Plus
lmd-PB 866 CG4677-PB 436..584 438..881 450 54 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:15:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12929782..12930646 462..1326 4325 100 Plus
2R 25286936 2R 12928879..12929341 1..463 2315 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:21:06
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12930981..12931845 462..1326 4325 100 Plus
2R 25260384 2R 12930078..12930540 1..463 2315 100 Plus
Blast to na_te.dros performed on 2014-11-27 15:15:44 has no hits.

LD36528.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:08:29 Download gff for LD36528.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8817109..8817969 464..1324 100   Plus
chr2R 8816204..8816666 1..463 91 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:19:03 Download gff for LD36528.complete
Subject Subject Range Query Range Percent Splice Strand
sug-RA 1..1155 54..1208 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:26:58 Download gff for LD36528.complete
Subject Subject Range Query Range Percent Splice Strand
sug-RA 1..1155 54..1208 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:25:11 Download gff for LD36528.complete
Subject Subject Range Query Range Percent Splice Strand
sug-RA 1..1155 54..1208 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:54:25 Download gff for LD36528.complete
Subject Subject Range Query Range Percent Splice Strand
sug-RA 1..1155 54..1208 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:08:29 Download gff for LD36528.complete
Subject Subject Range Query Range Percent Splice Strand
sug-RA 1..1155 54..1208 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:03:36 Download gff for LD36528.complete
Subject Subject Range Query Range Percent Splice Strand
sug-RA 17..1340 1..1324 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:26:58 Download gff for LD36528.complete
Subject Subject Range Query Range Percent Splice Strand
sug-RA 17..1340 1..1324 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:25:11 Download gff for LD36528.complete
Subject Subject Range Query Range Percent Splice Strand
sug-RA 20..1343 1..1324 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:54:25 Download gff for LD36528.complete
Subject Subject Range Query Range Percent Splice Strand
sug-RA 17..1340 1..1324 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:08:29 Download gff for LD36528.complete
Subject Subject Range Query Range Percent Splice Strand
sug-RA 20..1343 1..1324 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:08:29 Download gff for LD36528.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12929784..12930644 464..1324 100   Plus
2R 12928879..12929341 1..463 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:25:11 Download gff for LD36528.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8817289..8818149 464..1324 100   Plus
arm_2R 8816384..8816846 1..463 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:30:31 Download gff for LD36528.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12930983..12931843 464..1324 100   Plus
2R 12930078..12930540 1..463 100 -> Plus

LD36528.hyp Sequence

Translation from 2 to 1207

> LD36528.hyp
LAKATNFLDQHPPQTTNMDIIQKSIFNSGPHSRGIYEPPLGYFTPYNTPP
YIAAYSDSGSWLADHHQHHQQQHQQHQQQMQHIRFPTPPITPPRPIAGYG
YRQRTQSVIMKARGQQDELCRSPVEFPDDSKSCSSSSECGTASDFVCNWT
DCDRVFDTLDALAQHVTQRHAIASLTDGLYYCRWRGCQRSERGFNARYKM
LVHTRTHTKEKPHRCHLCEKSFSRAENLKIHIRSHSGEKPYKCSFEGCQK
AYSNSSDRFKHTRTHSMEKPYMCKVAGCQKRYTDPSSLRKHVKTFKHSIH
LIASQPLTLPSVPCLLEASSESAFTCLPAASSVESTSSSSSARYYDDSNN
EPSDYSLKPKQDAEFSPSYWLGDRQHSYLHSEDFFVKMDVESPLDLRIHR
I*

LD36528.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:12:40
Subject Length Description Subject Range Query Range Score Percent Strand
sug-PA 384 CG3850-PA 1..384 18..401 2105 100 Plus
sug-PB 322 CG3850-PB 1..322 80..401 1751 100 Plus
ci-PB 1279 CG2125-PB 291..483 110..294 465 46.7 Plus
ci-PA 1397 CG2125-PA 409..601 110..294 465 46.7 Plus
lmd-PB 866 CG4677-PB 333..584 70..293 463 39.5 Plus

LD36528.pep Sequence

Translation from 53 to 1207

> LD36528.pep
MDIIQKSIFNSGPHSRGIYEPPLGYFTPYNTPPYIAAYSDSGSWLADHHQ
HHQQQHQQHQQQMQHIRFPTPPITPPRPIAGYGYRQRTQSVIMKARGQQD
ELCRSPVEFPDDSKSCSSSSECGTASDFVCNWTDCDRVFDTLDALAQHVT
QRHAIASLTDGLYYCRWRGCQRSERGFNARYKMLVHTRTHTKEKPHRCHL
CEKSFSRAENLKIHIRSHSGEKPYKCSFEGCQKAYSNSSDRFKHTRTHSM
EKPYMCKVAGCQKRYTDPSSLRKHVKTFKHSIHLIASQPLTLPSVPCLLE
ASSESAFTCLPAASSVESTSSSSSARYYDDSNNEPSDYSLKPKQDAEFSP
SYWLGDRQHSYLHSEDFFVKMDVESPLDLRIHRI*

LD36528.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 04:04:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12930-PA 388 GF12930-PA 1..388 1..384 1505 79.8 Plus
Dana\GF19046-PA 1357 GF19046-PA 443..598 127..278 455 54.4 Plus
Dana\GF18275-PA 823 GF18275-PA 392..557 112..277 440 50.6 Plus
Dana\GF18915-PA 633 GF18915-PA 216..390 118..277 382 42.6 Plus
Dana\GF25133-PA 1011 GF25133-PA 380..525 128..282 253 36.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 04:04:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20347-PA 382 GG20347-PA 1..382 1..384 1666 92.2 Plus
Dere\GG16466-PA 1406 GG16466-PA 448..603 127..278 454 54.4 Plus
Dere\GG12470-PA 838 GG12470-PA 418..568 128..277 439 53.3 Plus
Dere\GG12590-PA 612 GG12590-PA 234..377 135..277 381 48.3 Plus
Dere\GG15376-PA 1002 GG15376-PA 357..503 128..283 246 35.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 04:04:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20305-PA 393 GH20305-PA 1..392 1..383 1045 60.1 Plus
Dgri\GH12994-PA 179 GH12994-PA 1..178 218..383 503 59.6 Plus
Dgri\GH23992-PA 1478 GH23992-PA 446..647 85..278 465 47.4 Plus
Dgri\GH23039-PA 669 GH23039-PA 277..420 135..277 380 48.3 Plus
Dgri\GH18235-PA 563 GH18235-PA 409..551 101..248 321 44 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 04:04:40
Subject Length Description Subject Range Query Range Score Percent Strand
sug-PA 384 CG3850-PA 1..384 1..384 2105 100 Plus
sug-PB 322 CG3850-PB 1..322 63..384 1751 100 Plus
ci-PB 1279 CG2125-PB 291..483 93..277 465 46.7 Plus
ci-PA 1397 CG2125-PA 409..601 93..277 465 46.7 Plus
lmd-PB 866 CG4677-PB 333..584 53..276 463 39.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 04:04:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19975-PA 381 GI19975-PA 1..380 1..383 1077 59.8 Plus
Dmoj\GI14119-PA 1463 GI14119-PA 453..608 127..278 462 54.4 Plus
Dmoj\GI10767-PA 780 GI10767-PA 411..564 125..277 436 52.3 Plus
Dmoj\GI10245-PA 653 GI10245-PA 265..408 135..277 379 47.6 Plus
Dmoj\GI16598-PA 994 GI16598-PA 354..499 128..282 249 35.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 04:04:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17162-PA 382 GL17162-PA 1..382 1..384 1352 75.2 Plus
Dper\GL18388-PA 1448 GL18388-PA 461..616 127..278 461 54.4 Plus
Dper\GL27360-PA 660 GL27360-PA 202..351 129..277 427 53 Plus
Dper\GL21621-PA 645 GL21621-PA 226..400 118..277 382 42 Plus
Dper\GL17877-PA 1045 GL17877-PA 395..540 128..282 249 34.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 04:04:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17730-PA 382 GA17730-PA 1..382 1..384 1359 75.7 Plus
Dpse\GA27838-PA 1448 GA27838-PA 461..616 127..278 461 54.4 Plus
Dpse\GA18349-PA 919 GA18349-PA 451..601 128..277 432 52.6 Plus
Dpse\GA10924-PA 645 GA10924-PA 226..400 118..277 382 42 Plus
Dpse\GA17655-PA 1046 GA17655-PA 395..540 128..282 249 34.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 04:04:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21434-PA 377 GM21434-PA 1..377 1..384 1766 96.1 Plus
Dsec\GM23237-PA 1404 GM23237-PA 414..607 93..278 456 46.4 Plus
Dsec\GM23601-PA 834 GM23601-PA 391..558 112..277 440 50.9 Plus
Dsec\GM10780-PA 492 GM10780-PA 202..376 118..277 380 42.6 Plus
Dsec\GM25148-PA 1002 GM25148-PA 358..504 128..283 246 35.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 04:04:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10932-PA 377 GD10932-PA 1..377 1..384 1770 96.6 Plus
Dsim\ci-PA 1402 GD24828-PA 414..605 93..278 469 47.7 Plus
Dsim\GD18414-PA 741 GD18414-PA 391..558 112..277 439 50.9 Plus
Dsim\GD19752-PA 609 GD19752-PA 202..376 118..277 384 42.6 Plus
Dsim\GD14182-PA 1004 GD14182-PA 358..504 128..283 246 35.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 04:04:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21228-PA 397 GJ21228-PA 22..396 19..383 995 58.6 Plus
Dvir\GJ14655-PA 1432 GJ14655-PA 456..611 127..278 465 54.4 Plus
Dvir\GJ14367-PA 858 GJ14367-PA 424..596 120..291 430 48.9 Plus
Dvir\GJ11051-PA 669 GJ11051-PA 272..415 135..277 378 47.6 Plus
Dvir\GJ12850-PA 536 GJ12850-PA 144..284 128..277 247 36.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 04:05:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20769-PA 368 GK20769-PA 1..367 1..383 1086 66.8 Plus
Dwil\GK13666-PA 1507 GK13666-PA 540..695 127..278 467 54.4 Plus
Dwil\GK11610-PA 700 GK11610-PA 391..569 97..277 454 47.5 Plus
Dwil\GK13239-PA 674 GK13239-PA 247..421 118..277 386 42 Plus
Dwil\GK11495-PA 620 GK11495-PA 486..589 170..277 244 40.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 04:05:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12506-PA 375 GE12506-PA 1..375 1..384 1733 94.8 Plus
Dyak\ci-PA 1406 GE14531-PA 422..608 111..278 456 49.2 Plus
Dyak\GE23994-PA 842 GE23994-PA 401..568 112..277 439 50.9 Plus
Dyak\GE25438-PA 870 GE25438-PA 328..502 118..277 381 42.6 Plus
Dyak\GE20840-PA 1005 GE20840-PA 357..503 128..283 247 35.9 Plus
Dyak\GE25438-PA 870 GE25438-PA 581..641 217..277 201 59 Plus
Dyak\GE25438-PA 870 GE25438-PA 199..315 118..219 184 34.7 Plus