Clone LD37002 Report

Search the DGRC for LD37002

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:370
Well:2
Vector:pOT2
Associated Gene/TranscriptSyx18-RA
Protein status:LD37002.pep: gold
Preliminary Size:1512
Sequenced Size:1417

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13626 2001-01-01 Release 2 assignment
CG13626 2001-07-04 Blastp of sequenced clone
CG13626 2003-01-01 Sim4 clustering to Release 3
Syx18 2008-04-29 Release 5.5 accounting
Syx18 2008-08-15 Release 5.9 accounting
Syx18 2008-12-18 5.12 accounting

Clone Sequence Records

LD37002.complete Sequence

1417 bp (1417 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051876

> LD37002.complete
TGGATTTAAAAGTTAAATATTTCAAACTTAGTTATAGCAAATAGCTATGG
ACATCACCCAGAGCTTCAAGGCCAGCGTAATGACGGTGCGCCTGCAGCGC
AAGGCCGAGCTGGCCGGAAAGGCCAAGCCCGCCACAGTGCCGACAAAAAC
TGGACCAATTGGCCCAAAGGATGACTTCGCCAAGCAGGCCAAGGAGGTGT
GCAACAAGATCACTTCGCTGCGCAATGTGCTGATCGAGAACCGCACCGCC
TACATGCGCATTGGCCAGCACCTCAAGTCCGCCGCACACATGACCGACGC
GCAGCGGGATCTGATTGATCGCGAGTCGGAGAAGTTCGTCACCTTTTACA
CGCAGCACCTGGCCAAGATGCGCAGCGATTGGAAGAGCGCCAAGCGGAAG
CCGCAGGAGCGTCAGCACATCGACGCCGTGCTGGACCTGCTGGTCAGCTA
TTTGCACAGCGTGGAACAGATCTATCTGGACCAAAAGAAGTACCGTGTGC
AACACGAACTGGAAACCTATAGGCTGCTCAAGCTGGCGGCGGACAAAAAG
AAGATACCAGTGCGTCCGGCGGGCAGCAACAGTGGCAAGCTGGGCAGGCG
CCAGGTCAGCAACGATGACAGCGAAGCCACGAAGTCATCTTCACAAGCAA
ATGGCAACCACGACGAGTCCGCCGACAATGACTGGAATAACGACGCCTGG
GGCGACTGGGATGAAGACGAGGAAGGCGACGAGGTGGACGATCACGATGG
CGAGAAGGGCAAGGAAGCCAATCAGGCCAATCAACACAAACCGCGTACGC
GCAAACGAAGCAAAGCCAACAGATCGGATCTGAACAACTCATCCTCCAAG
ATGGCTCTGGATGAGGAGCTCCAGCAGCAGCAGGAGGCCGACGATGACGA
TCCCCTAAGCGCCGAGGATGTGCAGCTCTTCGAGGCGGAGAACGTACACA
TCTACAACTTTCTGCAGGGCGTCTCCGAGGAGGTGGAGCAGATCGAAAAG
AACGTGGTAGACATTGCCCAACTGCAGGACATTTTCACCGAAAAGGTCGC
CATGCAACAGCACAATATCGACAGGATAGTTAGTGCCGTCGTGGGCACCA
CGGAAAACGTCAAGGACGCCAACGAGCAAATCCGGCAGGCCACTCAACGA
AATGCAGGACTACGCGTGTGGTCGCTGTTCTTCCTGCTGGTCATGTCGTT
CTCCCTGCTCTTCTTGGACTGGTACTACGATTAAGTGAAGTCCCCAAATT
TATGTGTAACCCACCCAATTTAGGGAATGATAAATGCAAAAATGTTTTGT
TATCGTTTGATCGCACTAAAAGCATATTTTGTTTATTACATAATTTATAA
ATAAAAGGAAAATATTTGTTTAGGCTATTCAACTGCCTTGTTTCAATTCA
AAAAAAAAAAAAAAAAA

LD37002.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:38:52
Subject Length Description Subject Range Query Range Score Percent Strand
Syx18-RA 1570 Syx18-RA 84..1484 1..1401 7005 100 Plus
mld.f 6244 mld.f 6145..6244 1401..1302 500 100 Minus
mld.e 6307 mld.e 6208..6307 1401..1302 500 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 04:04:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 20447721..20448767 1047..1 5235 100 Minus
chr3R 27901430 chr3R 20447050..20447405 1399..1044 1780 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:04:26
Subject Length Description Subject Range Query Range Score Percent Strand
Syx18-RA 1188 CG13626-PA 1..1188 47..1234 5940 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:31:44 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:04:25
Subject Length Description Subject Range Query Range Score Percent Strand
Syx18-RA 1442 CG13626-RA 44..1442 1..1399 6995 100 Plus
mld-RA 6957 CG34100-RA 6860..6957 1399..1302 490 100 Minus
mld-RE 7029 CG34100-RE 6932..7029 1399..1302 490 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 04:04:28
Subject Length Description Subject Range Query Range Score Percent Strand
Syx18-PA 395 CG13626-PA 1..395 47..1231 1633 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 04:04:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24624473..24625519 1047..1 5235 100 Minus
3R 32079331 3R 24623800..24624157 1401..1044 1790 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:00:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24365304..24366350 1047..1 5235 100 Minus
3R 31820162 3R 24364631..24364988 1401..1044 1790 100 Minus
Blast to na_te.dros performed on 2014-11-27 04:04:24 has no hits.

LD37002.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:06:25 Download gff for LD37002.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 20448118..20448767 1..650 100   Minus
chr3R 20447723..20448014 754..1045 100 == Minus
chr3R 20447050..20447403 1046..1399 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:19:22 Download gff for LD37002.complete
Subject Subject Range Query Range Percent Splice Strand
Syx18-RA 1..1188 47..1234 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:30:33 Download gff for LD37002.complete
Subject Subject Range Query Range Percent Splice Strand
Syx18-RA 1..1188 47..1234 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:11:02 Download gff for LD37002.complete
Subject Subject Range Query Range Percent Splice Strand
Syx18-RA 1..1188 47..1234 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:04:06 Download gff for LD37002.complete
Subject Subject Range Query Range Percent Splice Strand
Syx18-RA 1..1188 47..1234 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:06:25 Download gff for LD37002.complete
Subject Subject Range Query Range Percent Splice Strand
Syx18-RA 1..1188 47..1234 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:31:25 Download gff for LD37002.complete
Subject Subject Range Query Range Percent Splice Strand
Syx18-RA 62..1460 1..1399 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:30:33 Download gff for LD37002.complete
Subject Subject Range Query Range Percent Splice Strand
Syx18-RA 62..1460 1..1399 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:11:02 Download gff for LD37002.complete
Subject Subject Range Query Range Percent Splice Strand
Syx18-RA 44..1442 1..1399 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:04:06 Download gff for LD37002.complete
Subject Subject Range Query Range Percent Splice Strand
Syx18-RA 62..1460 1..1399 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:06:25 Download gff for LD37002.complete
Subject Subject Range Query Range Percent Splice Strand
Syx18-RA 44..1442 1..1399 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:06:25 Download gff for LD37002.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24624475..24625519 1..1045 100   Minus
3R 24623802..24624155 1046..1399 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:11:02 Download gff for LD37002.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20450197..20451241 1..1045 100   Minus
arm_3R 20449524..20449877 1046..1399 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:42:11 Download gff for LD37002.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24365306..24366350 1..1045 100   Minus
3R 24364633..24364986 1046..1399 100 <- Minus

LD37002.pep Sequence

Translation from 46 to 1233

> LD37002.pep
MDITQSFKASVMTVRLQRKAELAGKAKPATVPTKTGPIGPKDDFAKQAKE
VCNKITSLRNVLIENRTAYMRIGQHLKSAAHMTDAQRDLIDRESEKFVTF
YTQHLAKMRSDWKSAKRKPQERQHIDAVLDLLVSYLHSVEQIYLDQKKYR
VQHELETYRLLKLAADKKKIPVRPAGSNSGKLGRRQVSNDDSEATKSSSQ
ANGNHDESADNDWNNDAWGDWDEDEEGDEVDDHDGEKGKEANQANQHKPR
TRKRSKANRSDLNNSSSKMALDEELQQQQEADDDDPLSAEDVQLFEAENV
HIYNFLQGVSEEVEQIEKNVVDIAQLQDIFTEKVAMQQHNIDRIVSAVVG
TTENVKDANEQIRQATQRNAGLRVWSLFFLLVMSFSLLFLDWYYD*

LD37002.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 04:36:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20704-PA 399 GF20704-PA 1..399 1..395 1553 75.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 04:36:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12334-PA 395 GG12334-PA 1..395 1..395 1991 93.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 04:36:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19400-PA 398 GH19400-PA 1..398 1..395 1489 73.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 04:36:38
Subject Length Description Subject Range Query Range Score Percent Strand
Syx18-PA 395 CG13626-PA 1..395 1..395 2034 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 04:36:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22603-PA 399 GI22603-PA 1..399 1..395 1526 73.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 04:36:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22230-PA 396 GL22230-PA 1..396 1..395 1496 73.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 04:36:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12418-PA 398 GA12418-PA 1..398 1..395 1507 74.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 04:36:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23475-PA 395 GM23475-PA 1..395 1..395 1888 97.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 04:36:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18283-PA 395 GD18283-PA 1..395 1..395 1893 98 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 04:36:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23849-PA 394 GJ23849-PA 1..394 1..395 1548 75.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 04:36:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14303-PA 400 GK14303-PA 1..400 1..395 1488 72.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 04:36:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Syx18-PA 395 GE10788-PA 1..395 1..395 2003 94.4 Plus

LD37002.hyp Sequence

Translation from 46 to 1233

> LD37002.hyp
MDITQSFKASVMTVRLQRKAELAGKAKPATVPTKTGPIGPKDDFAKQAKE
VCNKITSLRNVLIENRTAYMRIGQHLKSAAHMTDAQRDLIDRESEKFVTF
YTQHLAKMRSDWKSAKRKPQERQHIDAVLDLLVSYLHSVEQIYLDQKKYR
VQHELETYRLLKLAADKKKIPVRPAGSNSGKLGRRQVSNDDSEATKSSSQ
ANGNHDESADNDWNNDAWGDWDEDEEGDEVDDHDGEKGKEANQANQHKPR
TRKRSKANRSDLNNSSSKMALDEELQQQQEADDDDPLSAEDVQLFEAENV
HIYNFLQGVSEEVEQIEKNVVDIAQLQDIFTEKVAMQQHNIDRIVSAVVG
TTENVKDANEQIRQATQRNAGLRVWSLFFLLVMSFSLLFLDWYYD*

LD37002.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:16:29
Subject Length Description Subject Range Query Range Score Percent Strand
Syx18-PA 395 CG13626-PA 1..395 1..395 2034 100 Plus