Clone LD37115 Report

Search the DGRC for LD37115

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:371
Well:15
Vector:pOT2
Associated Gene/Transcriptshtd-RB
Protein status:LD37115.pep: wuzgold
Preliminary Size:1777
Sequenced Size:1799

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9198 2001-07-04 Blastp of sequenced clone
CG9198 2003-01-01 Sim4 clustering to Release 3
shtd 2008-04-29 Release 5.5 accounting
shtd 2008-08-15 Release 5.9 accounting
shtd 2008-12-18 5.12 accounting

Clone Sequence Records

LD37115.complete Sequence

1799 bp (1799 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051879

> LD37115.complete
CTCGCAAGCCTATTGCAATATCATGGCTGGAGCTGCCTTCTGCATTGGTC
TCAAGTACGCCGGCACTGAGAATCTGGTGGCCTTTGCCACGCTGCGGTCG
GTGATAAAGGATTTCCTTCGCTTCCCCAGCAGGCCGATGGGCGAATGTGC
CGGTCGCACCACTGTGGAGAGCTGCCTGATGGTGCTGCTCATCTCGATCT
CGTTGGTGTTCGCCGGCTCCGGCAACTGCGAAATTCTTCGCATAATTCGG
TTTCTCAGGTCGCGAGTGGGACCACAATATCCGCACATAACCTACGGCTC
TCACATGGCCATACACATGTCGCTTGGCCTGCTATTCCTCGGCGCGGGTC
GCTTCACCATTTCCCAGACACCGGAGTCGATTGCTGCACTGGTCTGCGCC
TTCTTCCCCAAGTTTCCCATACACAGCAACGACAATCGATACCATCTGCA
AGCGCTGAGACATCTCTATGTACTGGCTGTGGAACCGCGCCTGTTCCTTC
CCCGGGACATTGACACCAATAAGCTGTGCCTGGCCAACATATCCGTGTTG
GAGGTGGGTGCCACCGAGCTGCGCCGCCTGCCCATCGCTCCCTGCATCCT
GCCAGTGCTGAGCACCCTGCAGCAGGTGGTGGTGGACGACGAGAACTATT
GGCCAGTGTGCTTCGAGCGATCGCGCAACTGGGATCAGCTGGAAAAGGCG
CTGGAGATGAGTGCACCGATTGATATTAAGAAGCGAACGGGCTGCCTTTC
CCACTTGGAGGACCCGGACAGGCTGAAGAGCATGCTGGCCCAAACATTGA
CGATGGAACAGAGCATCTGTTGGCAGATCGATATGAACGACCTGCAGCAG
TTTGCCAGCGAACGTATGGTGAAGCAGTTCCTCAGTCGCTGCCTGGACAC
CAAAGGCACGGATTTGAGTCCCCCGGAGCTGATGAAGCGGCACCAGGTGA
TGCTGCTATTCTACAATGCCGTGGTCAAGGATCGCATGCATTTCCTGCCG
GTTTACCTAACCCTATACGATCACGTAACCAAGTCCATGCCGAACAACAT
CGATGTGTGGCAGATGAAGCTCATCGATGCCTATTTGAGTCGCAGCCAGG
AGTCCGAGCATCCGCTCATCTCCGTGGAGCTTATCCAAATGATGCAAGAG
CTCTTCAAGCAGGAAATGGAGGACTCGACGCGCGAGTTGTGCTTACCGCT
GCGCGAGTTCCTCAGCCGAAGGCGTCTGGATCCCAGCTATGTGACCACAG
TCAGTGGACCGGACTTGCAGCGAGCCTTCTGCGTGATCAATTACTACAAT
CTGTTGCCGAATATGTTGAATGGAGTGGACTTGAGCACGGGCACAGTTAA
CTATATGCGTCTTTTATACGAATTCCGCCGGCTGAATCTCGGCGCGCACA
CCATATTTGGCCTAATGAAGATCCTACAGTCACTGGCCACCGAAGTGGTG
ACTCTGGATGAGGCAGCCCTTCTGGCGTACACCATGGGTGACCAGTGATG
ATCGATGGAAATTCTTTTTTGCTAGACCCATATTACTGTACATTCATTTC
TAAATAATATTATTGCACATTATTTCAAAATTTCGCCGCCACTTATAATC
GAAACTTTGCATAAAAGTTTGCTGCCCAACTCTTGAAATTATATTGTTAT
ACAATCACGTCGAAACGTTTTGGATATGAATATTTAAATGCATGTTCCTT
AATGTTTAACGATTTAACGATAGCACAAAAACTGTATAAAATATATTTAC
AAATAAATAGCCCATAACGCTTGCAAAATTAAAAAAAAAAAAAAAAAAA

LD37115.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:29:56
Subject Length Description Subject Range Query Range Score Percent Strand
shtd-RA 6564 shtd-RA 4780..6561 1..1782 8910 100 Plus
shtd.a 2224 shtd.a 440..2221 1..1782 8910 100 Plus
shtd.b 2549 shtd.b 765..2546 1..1782 8910 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:19:48
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 15345485..15346243 1780..1022 3795 100 Minus
chrX 22417052 chrX 15346303..15346886 1021..438 2920 100 Minus
chrX 22417052 chrX 15346950..15347384 438..4 2175 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:19:45
Subject Length Description Subject Range Query Range Score Percent Strand
shtd-RA 6093 CG9198-PA 4596..6093 1..1498 7490 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:31:48 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:19:44
Subject Length Description Subject Range Query Range Score Percent Strand
shtd-RA 6481 CG9198-RA 4702..6481 1..1780 8900 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:19:47
Subject Length Description Subject Range Query Range Score Percent Strand
shtd-PA 2030 CG9198-PA 1533..2030 2..1495 2579 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:19:43
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15455542..15456302 1782..1022 3805 100 Minus
X 23542271 X 15456362..15456945 1021..438 2920 100 Minus
X 23542271 X 15457009..15457443 438..4 2175 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:52:13
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 15463640..15464400 1782..1022 3805 100 Minus
X 23527363 X 15464460..15465043 1021..438 2920 100 Minus
X 23527363 X 15465107..15465541 438..4 2175 100 Minus
Blast to na_te.dros performed on 2014-11-27 03:19:43 has no hits.

LD37115.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 04:32:53 Download gff for LD37115.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 15346950..15347387 1..438 99   Minus
chrX 15346303..15346885 439..1021 100 <- Minus
chrX 15345485..15346243 1022..1780 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:19:28 Download gff for LD37115.complete
Subject Subject Range Query Range Percent Splice Strand
shtd-RA 4596..6093 1..1498 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:17:53 Download gff for LD37115.complete
Subject Subject Range Query Range Percent Splice Strand
shtd-RA 4596..6093 1..1498 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:05:51 Download gff for LD37115.complete
Subject Subject Range Query Range Percent Splice Strand
shtd-RA 4596..6093 1..1498 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:49:23 Download gff for LD37115.complete
Subject Subject Range Query Range Percent Splice Strand
shtd-RA 4596..6093 1..1498 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:32:53 Download gff for LD37115.complete
Subject Subject Range Query Range Percent Splice Strand
shtd-RA 4596..6093 1..1498 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:12:52 Download gff for LD37115.complete
Subject Subject Range Query Range Percent Splice Strand
shtd-RA 4596..6375 1..1780 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:17:53 Download gff for LD37115.complete
Subject Subject Range Query Range Percent Splice Strand
shtd-RA 4596..6375 1..1780 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:05:51 Download gff for LD37115.complete
Subject Subject Range Query Range Percent Splice Strand
shtd-RA 4702..6481 1..1780 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:49:24 Download gff for LD37115.complete
Subject Subject Range Query Range Percent Splice Strand
shtd-RA 4596..6375 1..1780 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:32:53 Download gff for LD37115.complete
Subject Subject Range Query Range Percent Splice Strand
shtd-RA 4702..6481 1..1780 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 04:32:53 Download gff for LD37115.complete
Subject Subject Range Query Range Percent Splice Strand
X 15457009..15457446 1..438 99   Minus
X 15456362..15456944 439..1021 100 <- Minus
X 15455544..15456302 1022..1780 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:05:51 Download gff for LD37115.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15351042..15351479 1..438 99   Minus
arm_X 15350395..15350977 439..1021 100 <- Minus
arm_X 15349577..15350335 1022..1780 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:27:37 Download gff for LD37115.complete
Subject Subject Range Query Range Percent Splice Strand
X 15465107..15465544 1..438 99   Minus
X 15464460..15465042 439..1021 100 <- Minus
X 15463642..15464400 1022..1780 100 <- Minus

LD37115.hyp Sequence

Translation from 0 to 1497

> LD37115.hyp
RQAYCNIMAGAAFCIGLKYAGTENLVAFATLRSVIKDFLRFPSRPMGECA
GRTTVESCLMVLLISISLVFAGSGNCEILRIIRFLRSRVGPQYPHITYGS
HMAIHMSLGLLFLGAGRFTISQTPESIAALVCAFFPKFPIHSNDNRYHLQ
ALRHLYVLAVEPRLFLPRDIDTNKLCLANISVLEVGATELRRLPIAPCIL
PVLSTLQQVVVDDENYWPVCFERSRNWDQLEKALEMSAPIDIKKRTGCLS
HLEDPDRLKSMLAQTLTMEQSICWQIDMNDLQQFASERMVKQFLSRCLDT
KGTDLSPPELMKRHQVMLLFYNAVVKDRMHFLPVYLTLYDHVTKSMPNNI
DVWQMKLIDAYLSRSQESEHPLISVELIQMMQELFKQEMEDSTRELCLPL
REFLSRRRLDPSYVTTVSGPDLQRAFCVINYYNLLPNMLNGVDLSTGTVN
YMRLLYEFRRLNLGAHTIFGLMKILQSLATEVVTLDEAALLAYTMGDQ*

LD37115.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:46:34
Subject Length Description Subject Range Query Range Score Percent Strand
shtd-PA 2030 CG9198-PA 1534..2030 2..498 2575 100 Plus

LD37115.pep Sequence

Translation from 22 to 1497

> LD37115.pep
MAGAAFCIGLKYAGTENLVAFATLRSVIKDFLRFPSRPMGECAGRTTVES
CLMVLLISISLVFAGSGNCEILRIIRFLRSRVGPQYPHITYGSHMAIHMS
LGLLFLGAGRFTISQTPESIAALVCAFFPKFPIHSNDNRYHLQALRHLYV
LAVEPRLFLPRDIDTNKLCLANISVLEVGATELRRLPIAPCILPVLSTLQ
QVVVDDENYWPVCFERSRNWDQLEKALEMSAPIDIKKRTGCLSHLEDPDR
LKSMLAQTLTMEQSICWQIDMNDLQQFASERMVKQFLSRCLDTKGTDLSP
PELMKRHQVMLLFYNAVVKDRMHFLPVYLTLYDHVTKSMPNNIDVWQMKL
IDAYLSRSQESEHPLISVELIQMMQELFKQEMEDSTRELCLPLREFLSRR
RLDPSYVTTVSGPDLQRAFCVINYYNLLPNMLNGVDLSTGTVNYMRLLYE
FRRLNLGAHTIFGLMKILQSLATEVVTLDEAALLAYTMGDQ*

LD37115.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 04:36:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21034-PA 2030 GF21034-PA 1538..2030 1..491 2366 88.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 04:36:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19400-PA 2031 GG19400-PA 1541..2031 1..491 2467 93.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 04:36:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24489-PA 3505 GH24489-PA 1578..1913 1..336 1621 88.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 04:36:53
Subject Length Description Subject Range Query Range Score Percent Strand
shtd-PA 2030 CG9198-PA 1540..2030 1..491 2540 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 04:36:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15242-PA 2019 GI15242-PA 1532..2005 1..474 2111 80.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 04:36:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14737-PA 1997 GL14737-PA 1505..1995 1..489 2176 81.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 04:37:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21606-PA 2023 GA21606-PA 1531..2023 1..491 2200 82.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 04:37:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19547-PA 2005 GM19547-PA 1515..2005 1..491 2606 98.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 04:37:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15798-PA 1045 GD15798-PA 555..1045 1..491 2588 97.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 04:37:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16572-PA 2014 GJ16572-PA 1531..2005 1..476 2123 81.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 04:37:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20008-PA 2047 GK20008-PA 1554..2029 1..476 2181 83.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 04:37:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16046-PA 2028 GE16046-PA 1538..2028 1..491 2505 94.5 Plus