Clone LD37257 Report

Search the DGRC for LD37257

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:372
Well:57
Vector:pOT2
Associated Gene/TranscriptRAF2-RA
Protein status:LD37257.pep: gold
Sequenced Size:3997

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4877 2003-01-01 Sim4 clustering to Release 3
CG4877 2005-03-04 Blastp of sequenced clone
CG4877 2008-04-29 Release 5.5 accounting
CG4877 2008-08-15 Release 5.9 accounting
CG4877 2008-12-18 5.12 accounting

Clone Sequence Records

LD37257.complete Sequence

3997 bp (3997 high quality bases) assembled on 2005-03-04

GenBank Submission: BT021383

> LD37257.complete
AATTATTCGCAGAATTGAACGGCGAATTTTTTTTCGCATTTGGAAATTGG
ATTTTTGCTGAAAGTAAACGCTTTAAAACTGGTATAAACCCGAATTAGCC
TATTTGGGGACTTGGGCCATTGTTTTAAGTGGTTTTCAGCAACTGAAAAG
GTGAGCCCGTCGGCGGATTAGAATATTCAACCGGCAGACGATTTTTTGTT
GGCCAAAAATTTGCAGACGTGAGCGCTTGCAGGCCTAATGTCCAACGAGA
TCTACGACTCCTCCAATTCGCAGCTAAGTAGCGACGAGTATAGCCACGAG
GAGGAGGAATACGACGCTCTAATGGACGCGGCGGTGAGCAAGCAACGACC
CCAAAAGACAAAATCCAAGGGATCCGAGTCCGAGAAACCCGGAAATGGAG
CTCCAGAATCGGCGGCTGCCACTGAGAAAAATGAAAAGCCAGATGACGAT
GCGGTGCCACCTTCCACGCGCTCAGAAACAATTCGGCGGATCCGGCAATT
GCAGTTACAGCGTGGCAGGCTGCCCAATCTTTACTTCAAGCGTCGCAGTA
TTCGTTGGCTGCGACCCAATAAAATGGACTACAACAGCTATTTTGACGGC
CTGAAGGACTTGCTGCCCAAGCGTAAATTGAAGCACCTGGTTCGCTTCCA
TGACAGGCAGCGCAGAACCTACGACAGCAGGAGCATCAGTCGTAGTCGCA
GCCACAGCCGCAGTCTTAGCCGAAGTTGCAGTCGCAGTCGTAGTCGTAGC
TATTCTCGCAGCCGCAGCGGCAGTGGTTCGCCGGAACTCATTTGCCTTGA
CGACACGGAGAACGAGGATTCGCCTGAGAAACCAGAGCAAGAGCCGGCAA
GGGTTACGCCCATCAAGGAAAATAAGCCTACGCTTCCGGCTCCACCCCAA
CTAAACTACGAGCTGCCAGAAAGGAAGAAAGCAAACCCACTTGGAAACAA
CGAAAACGGTGCCTCTATCCTCGACGAGTTCCTGGTAAAGAAGGATCCCC
AGGAACCGGTCTTCGACTACGGTAAACTCTCAGCGTGTCGGGAATTGGAA
CAGGCTCTAAAGGACCGGTCGCGAGATGCGCCAAATGAGGCAGAGTCGCT
TGTGGTTGATGCCACTCTTAAAAGACGCCGTTCGGTAACACCGCCCGCTA
GCGAAGAGAAGCGCAACAATGAAGTCGAGGATGATAATATAATTGGGTTT
TCAACGGTGCAGCAACAGAAGCCAATGGAGGCAGCTCCACCATTAAATCT
AAGAATGCCCACCACTCCATCGACTAATCCTCTTCAGCGTCAGCAGGCTT
TTAAGCTGAGCACACCGTATACCCTGGCTCCGCCTACTGCCGCCAAGCAA
GCTGACACTTACAGTTTAAATACTCCACCGCCAACGGCCACCCAAATGCA
GATATCCTATCCCAACGAAAAGCTGTCAAATAACATGAAAGCTAATGCGA
CTTTCTCGATTCAACAGACAGCTTTATCCCAAGTCGCTGCATCCTATGCT
GCTGCACCACAAGTGGCTGCCCTCGCGCAGAGAGCTCCATCTCAGGTTGC
TCCACTACAACAAGCCCCCGTGCAACAGATGCACTTCCCAAGATCAGTTC
CACCGCAGCAGCTTCCTCCACCACAGCAGCGAGCTCCTCCACAGCAACTG
GCTACAGCTCCATTCGCTCCACCACGGCACCTGGCTCAACATAGACCATC
TCCACAGCAGCTAGCTCCATCACAGCAGCTGGCTCCACCACACCAGCTAG
CTCCACCACACCAGCTAGCTCCACCACAGCAGCGAGCTCCGCCACAGCAG
CTAGCTCCACCACACCAGCTAGCTCCACCACACCAGCTAGCTCCACCACA
GCAGCGAGCTCCGCCACAGCAGCTAGCTCCGCCACAGCAGCTAGCTCCAC
CACAGCAGCTAGCTCCACCACAGCAGCTAGCTCCACCACAGCAGCTAGCT
CCACCACAGCAGCGAGCTCCGCCACAGCAGCGAGCTCCGCCACAGCAGCT
GGCTCCGCCACAACAGCGAGCTCCCACACAGCATATGGCTCCACCACAAC
ATATGGCTCCGCCACAGCAGCTAGCTCCAACACAGCAGCTAGCTCCTCCA
CCACAGCAGCTAGCGCCTCGACCACAGCAGCTAGCTCCTCCACCACAGCA
ACTAGCTCCTCCACCACAGCAGCTAGCTCCTCCACCACAGCAGCCAGATT
CATCAAGACCAGCTTCGGTGCAGCCGTTGACCCCTCAAAGGCATGCTAGT
CCACATCAGCTTGCCCAATCACAGCAGGTCCATCAATCGCCATCTCAACT
GCATCCTGTTCCAGTGGCTGCTCCCAACTTTGCGGTGCCCCAACAGCCGC
AACCCCGTCGATCGGAAACGGTGAGCACCCAGACGCAGGGCTTGGGGTCA
CCAGCGGCTTCTTCTTCGACAACCCGCCAAAAGTCATTCGTTGATCTCAA
TAATAGTGATGCAAACTTCCATTATCGCGTCAAAGAACTTTTCGATGAAT
TGAACTCGACAATGATTGATAAAATTAACTCGGTACCCCCTGATGAAGAT
TCATTGAAAAAAGAGCGCGAACGCATCGTTGCGGATCTTGCAGCCCTAGA
TAAGCTGATGGCCCAGAAAGAGGATGAATATAACCGACTGCTGTATTTGA
GCTGCATTAAGAAGGAGCTGCATGAACGAATGGAGCGAAAGGAGCGCTTG
ATACGTATTAAGGACCTACTGCCCATCCTTATCAACAAGTGCGGCACCAA
GGAGCTCAGTGAGGTAAAGGCTATGCTAGAAGAGGAAATCGATTCTCCAA
TGGCCTCCAAACATAGTTTGTCGGCAATTGAAAAATTACTGAATTACGCC
GAGTTAAACCAGAACATCATACAGCTTCTGCGGGGTTCCTTGGGCTTAAA
TAAACGCGCACCGTCCGTGTCTCCGGCCAATTTCGAGGATGACCAAATGC
TTTTTCGTAGAGATTCCTTGCCCGTAAGTCATCTATCAATGCGGGATCAG
CATTACGAATCTCGGAATGCGGTAAATGACCATCTGCTAGATAGCAATCC
AGACAGAGATCCGCCAGCCAAGCGACCGAAGCTAATCCACTCGCAAGACA
GTAACCAGGACATGGCAAGCTCCTCGACACATTTGTCAGCCAATCTTTCA
GAGACGCTTCGCAAGATTAGGGCTTGGAAAAATTATTCGCATTTTAGTAA
CGTCTCAATGGAGGACAATAATTCGGATAATGAATCACAGATCGAACCGC
TGTTCAACAGCAGTCCGATGGCCTCCCGTCGCCAACTGGCCAATAGACAG
TCCTACCAAGAACAACATTCCGCTAATATCAACGACCATGAGAATGTCCA
AAAGAGGCACAAGTCTCACAAGCGCAAGTCGCATAAGCACAAGTCTCACA
AGCATAGGAGCTCCCATAAGTCCCAGGCTGAATCTTCCGCCACCATCAAC
GGTAACACAGGTAGACAATGCCACGAGTGCAAGCTCTATGGAGCCACCTT
TATGTGCTCCAACTGTCAGAATCAATGGTACTGCAGTCGTGAATGCCAGC
TGAGCGATTGGGACACACATCACCGAACTTGTGGCATTTAAATAGACTTC
ACTTAGGACATCAGCATTACTAAAACATAACTATATAGACGTATCGCATA
TGCACTACTATATATTTACTCAACCGTGTAACTCACTGAAGGACACAGGA
CACTGGCGGACCATTTTCAATTGCGTTTTATTGAATTAAGTGCTTGCAAT
TGTACTCAATCAATGAAGCACAATTTAAAGTGTAATATGCCTAGCTATTA
TAAGTTGGTAGGGATTAAATATAATAATTATAATTCCTTAATAATTGATT
CCAATTTGCTTATGAACAACGCGCGAAATTCATTTTGTTTCAAAATCGTA
TTGATAAAATGTTCCTCGTTTTCCCACTTTTTTTGTTTGAAAATTAAATA
TCCTTGACTTCTTGTTTGCTACATAAAAAAAAAAAAAAAAAAAAAAA

LD37257.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:53:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG4877-RA 4073 CG4877-RA 4..3981 1..3978 19890 100 Plus
CG4877-RB 4001 CG4877-RB 156..3907 227..3978 18760 100 Plus
CG4877.a 4005 CG4877.a 164..3911 231..3978 18740 100 Plus
CG4877.a 4005 CG4877.a 16..166 1..151 755 100 Plus
CG4877-RB 4001 CG4877-RB 6..155 1..150 750 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 21:10:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16376799..16379139 557..2885 11385 99.2 Plus
chr3L 24539361 chr3L 16380069..16380495 3548..3974 2135 100 Plus
chr3L 24539361 chr3L 16376405..16376736 227..558 1630 99.4 Plus
chr3L 24539361 chr3L 16377956..16378404 1738..2192 1320 87 Plus
chr3L 24539361 chr3L 16379724..16379975 3298..3549 1260 100 Plus
chr3L 24539361 chr3L 16378010..16378446 1702..2150 1200 85.4 Plus
chr3L 24539361 chr3L 16376124..16376349 1..226 1115 99.6 Plus
chr3L 24539361 chr3L 16377956..16378278 1774..2096 1105 89.5 Plus
chr3L 24539361 chr3L 16379195..16379411 2885..3101 1085 100 Plus
chr3L 24539361 chr3L 16377956..16378271 1792..2107 1070 89.2 Plus
chr3L 24539361 chr3L 16379468..16379668 3100..3300 1005 100 Plus
chr3L 24539361 chr3L 16377956..16378229 1828..2101 935 89.4 Plus
chr3L 24539361 chr3L 16377956..16378211 1846..2101 830 88.3 Plus
chr3L 24539361 chr3L 16377956..16378211 1882..2143 790 88.5 Plus
chr3L 24539361 chr3L 16377956..16378229 1864..2143 760 86.4 Plus
chr3L 24539361 chr3L 16377956..16378229 1900..2185 720 86.7 Plus
chr3L 24539361 chr3L 16377956..16378211 1918..2185 555 84 Plus
chr3L 24539361 chr3L 16377956..16378193 1936..2185 495 83.6 Plus
chr3L 24539361 chr3L 16377956..16378085 1972..2101 365 85.4 Plus
chr3L 24539361 chr3L 16377956..16378175 1954..2185 360 81 Plus
chr3L 24539361 chr3L 16377956..16378103 1990..2143 265 81.2 Plus
chr3L 24539361 chr3L 16377956..16378085 2008..2143 250 82.4 Plus
chr3L 24539361 chr3L 16377957..16378103 2027..2185 220 81.8 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:10:44
Subject Length Description Subject Range Query Range Score Percent Strand
RAF2-RC 3354 CG4877-PC 1..3354 238..3591 16770 100 Plus
RAF2-RA 3354 CG4877-PA 1..3354 238..3591 16770 100 Plus
RAF2-RB 3354 CG4877-PB 1..3354 238..3591 16770 100 Plus
RAF2-RC 3354 CG4877-PC 1465..1913 1738..2192 1335 87.3 Plus
RAF2-RA 3354 CG4877-PA 1465..1913 1738..2192 1335 87.3 Plus
RAF2-RC 3354 CG4877-PC 1519..1955 1702..2150 1230 85.8 Plus
RAF2-RA 3354 CG4877-PA 1519..1955 1702..2150 1230 85.8 Plus
RAF2-RC 3354 CG4877-PC 1465..1894 1774..2194 1105 84.8 Plus
RAF2-RA 3354 CG4877-PA 1465..1894 1774..2194 1105 84.8 Plus
RAF2-RC 3354 CG4877-PC 1465..1780 1792..2107 1070 89.2 Plus
RAF2-RA 3354 CG4877-PA 1465..1780 1792..2107 1070 89.2 Plus
RAF2-RC 3354 CG4877-PC 1465..1756 1810..2101 965 88.7 Plus
RAF2-RA 3354 CG4877-PA 1465..1756 1810..2101 965 88.7 Plus
RAF2-RC 3354 CG4877-PC 1465..1738 1828..2101 920 89.1 Plus
RAF2-RA 3354 CG4877-PA 1465..1738 1828..2101 920 89.1 Plus
RAF2-RC 3354 CG4877-PC 1465..1720 1846..2101 815 87.9 Plus
RAF2-RA 3354 CG4877-PA 1465..1720 1846..2101 815 87.9 Plus
RAF2-RC 3354 CG4877-PC 1465..1738 1864..2143 775 86.8 Plus
RAF2-RC 3354 CG4877-PC 1465..1720 1882..2143 775 88.2 Plus
RAF2-RA 3354 CG4877-PA 1465..1738 1864..2143 775 86.8 Plus
RAF2-RA 3354 CG4877-PA 1465..1720 1882..2143 775 88.2 Plus
RAF2-RC 3354 CG4877-PC 1465..1738 1900..2185 705 86.4 Plus
RAF2-RA 3354 CG4877-PA 1465..1738 1900..2185 705 86.4 Plus
RAF2-RC 3354 CG4877-PC 1465..1720 1918..2185 570 84.3 Plus
RAF2-RA 3354 CG4877-PA 1465..1720 1918..2185 570 84.3 Plus
RAF2-RC 3354 CG4877-PC 1465..1702 1936..2185 495 83.6 Plus
RAF2-RA 3354 CG4877-PA 1465..1702 1936..2185 495 83.6 Plus
RAF2-RC 3354 CG4877-PC 1465..1684 1954..2185 360 81 Plus
RAF2-RC 3354 CG4877-PC 1465..1666 1972..2185 360 82.2 Plus
RAF2-RA 3354 CG4877-PA 1465..1684 1954..2185 360 81 Plus
RAF2-RA 3354 CG4877-PA 1465..1666 1972..2185 360 82.2 Plus
RAF2-RC 3354 CG4877-PC 1465..1648 1990..2185 255 80.1 Plus
RAF2-RC 3354 CG4877-PC 1465..1630 2008..2185 255 81.5 Plus
RAF2-RA 3354 CG4877-PA 1465..1648 1990..2185 255 80.1 Plus
RAF2-RA 3354 CG4877-PA 1465..1630 2008..2185 255 81.5 Plus
RAF2-RC 3354 CG4877-PC 1466..1612 2027..2185 205 81.1 Plus
RAF2-RA 3354 CG4877-PA 1466..1612 2027..2185 205 81.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:32:03 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:10:42
Subject Length Description Subject Range Query Range Score Percent Strand
RAF2-RA 4082 CG4877-RA 19..3992 1..3974 19870 100 Plus
RAF2-RC 4076 CG4877-RC 19..3986 1..3974 19745 99.8 Plus
RAF2-RB 4006 CG4877-RB 169..3916 227..3974 18740 100 Plus
RAF2-RA 4082 CG4877-RA 1720..2168 1738..2192 1335 87.3 Plus
RAF2-RC 4076 CG4877-RC 1714..2162 1738..2192 1335 87.3 Plus
RAF2-RA 4082 CG4877-RA 1774..2210 1702..2150 1230 85.8 Plus
RAF2-RC 4076 CG4877-RC 1768..2204 1702..2150 1230 85.8 Plus
RAF2-RA 4082 CG4877-RA 1720..2149 1774..2194 1105 84.8 Plus
RAF2-RC 4076 CG4877-RC 1714..2143 1774..2194 1105 84.8 Plus
RAF2-RA 4082 CG4877-RA 1720..2035 1792..2107 1070 89.2 Plus
RAF2-RC 4076 CG4877-RC 1714..2029 1792..2107 1070 89.2 Plus
RAF2-RA 4082 CG4877-RA 1720..2011 1810..2101 965 88.7 Plus
RAF2-RC 4076 CG4877-RC 1714..2005 1810..2101 965 88.7 Plus
RAF2-RA 4082 CG4877-RA 1720..1993 1828..2101 920 89.1 Plus
RAF2-RC 4076 CG4877-RC 1714..1987 1828..2101 920 89.1 Plus
RAF2-RA 4082 CG4877-RA 1720..1975 1846..2101 815 87.9 Plus
RAF2-RC 4076 CG4877-RC 1714..1969 1846..2101 815 87.9 Plus
RAF2-RA 4082 CG4877-RA 1720..1993 1864..2143 775 86.8 Plus
RAF2-RA 4082 CG4877-RA 1720..1975 1882..2143 775 88.2 Plus
RAF2-RC 4076 CG4877-RC 1714..1987 1864..2143 775 86.8 Plus
RAF2-RC 4076 CG4877-RC 1714..1969 1882..2143 775 88.2 Plus
RAF2-RA 4082 CG4877-RA 1720..1993 1900..2185 705 86.4 Plus
RAF2-RC 4076 CG4877-RC 1714..1987 1900..2185 705 86.4 Plus
RAF2-RA 4082 CG4877-RA 1720..1975 1918..2185 570 84.3 Plus
RAF2-RC 4076 CG4877-RC 1714..1969 1918..2185 570 84.3 Plus
RAF2-RA 4082 CG4877-RA 1720..1957 1936..2185 495 83.6 Plus
RAF2-RC 4076 CG4877-RC 1714..1951 1936..2185 495 83.6 Plus
RAF2-RA 4082 CG4877-RA 1720..1939 1954..2185 360 81 Plus
RAF2-RA 4082 CG4877-RA 1720..1921 1972..2185 360 82.2 Plus
RAF2-RC 4076 CG4877-RC 1714..1933 1954..2185 360 81 Plus
RAF2-RC 4076 CG4877-RC 1714..1915 1972..2185 360 82.2 Plus
RAF2-RA 4082 CG4877-RA 1720..1903 1990..2185 255 80.1 Plus
RAF2-RA 4082 CG4877-RA 1720..1885 2008..2185 255 81.5 Plus
RAF2-RC 4076 CG4877-RC 1714..1897 1990..2185 255 80.1 Plus
RAF2-RC 4076 CG4877-RC 1714..1879 2008..2185 255 81.5 Plus
RAF2-RA 4082 CG4877-RA 1721..1867 2027..2185 205 81.1 Plus
RAF2-RC 4076 CG4877-RC 1715..1861 2027..2185 205 81.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:10:50
Subject Length Description Subject Range Query Range Score Percent Strand
RAF2-PC 1117 CG4877-PC 654..1116 2197..3585 2155 100 Plus
RAF2-PA 1117 CG4877-PA 654..1116 2197..3585 2155 100 Plus
RAF2-PB 1117 CG4877-PB 654..1116 2197..3585 2155 100 Plus
RAF2-PC 1117 CG4877-PC 1..485 238..1692 1798 100 Plus
RAF2-PA 1117 CG4877-PA 1..485 238..1692 1798 100 Plus
RAF2-PB 1117 CG4877-PB 1..485 238..1692 1798 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:10:39
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16387020..16389348 557..2885 11645 100 Plus
3L 28110227 3L 16390300..16390730 3548..3978 2155 100 Plus
3L 28110227 3L 16386626..16386957 227..558 1660 100 Plus
3L 28110227 3L 16388165..16388613 1738..2192 1335 87.3 Plus
3L 28110227 3L 16389933..16390184 3298..3549 1260 100 Plus
3L 28110227 3L 16388219..16388655 1702..2150 1230 85.8 Plus
3L 28110227 3L 16386345..16386570 1..226 1130 100 Plus
3L 28110227 3L 16388165..16388594 1774..2194 1105 84.8 Plus
3L 28110227 3L 16389404..16389620 2885..3101 1085 100 Plus
3L 28110227 3L 16388165..16388480 1792..2107 1070 89.2 Plus
3L 28110227 3L 16389677..16389877 3100..3300 1005 100 Plus
3L 28110227 3L 16388165..16388456 1810..2101 965 88.7 Plus
3L 28110227 3L 16388165..16388438 1828..2101 920 89.1 Plus
3L 28110227 3L 16388165..16388420 1846..2101 815 87.9 Plus
3L 28110227 3L 16388165..16388438 1864..2143 775 86.8 Plus
3L 28110227 3L 16388165..16388420 1882..2143 775 88.2 Plus
3L 28110227 3L 16388165..16388438 1900..2185 705 86.4 Plus
3L 28110227 3L 16388165..16388420 1918..2185 570 84.3 Plus
3L 28110227 3L 16388165..16388402 1936..2185 495 83.6 Plus
3L 28110227 3L 16388165..16388384 1954..2185 360 81 Plus
3L 28110227 3L 16388165..16388366 1972..2185 360 82.2 Plus
3L 28110227 3L 16388165..16388348 1990..2185 255 80.1 Plus
3L 28110227 3L 16388165..16388330 2008..2185 255 81.5 Plus
3L 28110227 3L 16388166..16388312 2027..2185 205 81.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:42:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16380120..16382448 557..2885 11645 100 Plus
3L 28103327 3L 16383400..16383830 3548..3978 2155 100 Plus
3L 28103327 3L 16379726..16380057 227..558 1660 100 Plus
3L 28103327 3L 16383033..16383284 3298..3549 1260 100 Plus
3L 28103327 3L 16379445..16379670 1..226 1130 100 Plus
3L 28103327 3L 16382504..16382720 2885..3101 1085 100 Plus
3L 28103327 3L 16382777..16382977 3100..3300 1005 100 Plus
Blast to na_te.dros performed 2014-11-26 21:10:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6680..7083 1795..2198 291 58.7 Plus

LD37257.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:05:42 Download gff for LD37257.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16380071..16380495 3550..3974 100   Plus
chr3L 16379727..16379975 3301..3549 100 -> Plus
chr3L 16379470..16379668 3102..3300 100 -> Plus
chr3L 16379196..16379411 2886..3101 100 -> Plus
chr3L 16376800..16379139 558..2885 99 -> Plus
chr3L 16376405..16376735 227..557 99 -> Plus
chr3L 16376124..16376349 1..226 99 -> Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:26:07 Download gff for LD37257.complete
Subject Subject Range Query Range Percent Splice Strand
CG4877-RA 1..3354 238..3591 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:06:49 Download gff for LD37257.complete
Subject Subject Range Query Range Percent Splice Strand
RAF2-RB 1..3354 238..3591 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:10:14 Download gff for LD37257.complete
Subject Subject Range Query Range Percent Splice Strand
CG4877-RA 1..3354 238..3591 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:05:42 Download gff for LD37257.complete
Subject Subject Range Query Range Percent Splice Strand
RAF2-RB 1..3354 238..3591 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:28:54 Download gff for LD37257.complete
Subject Subject Range Query Range Percent Splice Strand
CG4877-RA 1..3974 1..3974 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:26:07 Download gff for LD37257.complete
Subject Subject Range Query Range Percent Splice Strand
CG4877-RA 1..3974 1..3974 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:06:49 Download gff for LD37257.complete
Subject Subject Range Query Range Percent Splice Strand
RAF2-RA 19..3992 1..3974 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:10:15 Download gff for LD37257.complete
Subject Subject Range Query Range Percent Splice Strand
CG4877-RA 1..3974 1..3974 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:05:42 Download gff for LD37257.complete
Subject Subject Range Query Range Percent Splice Strand
RAF2-RA 19..3992 1..3974 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:05:42 Download gff for LD37257.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16390302..16390726 3550..3974 100   Plus
3L 16389936..16390184 3301..3549 100 -> Plus
3L 16389679..16389877 3102..3300 100 -> Plus
3L 16389405..16389620 2886..3101 100 -> Plus
3L 16387021..16389348 558..2885 100 -> Plus
3L 16386626..16386956 227..557 100 -> Plus
3L 16386345..16386570 1..226 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:06:49 Download gff for LD37257.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16383402..16383826 3550..3974 100   Plus
arm_3L 16383036..16383284 3301..3549 100 -> Plus
arm_3L 16382779..16382977 3102..3300 100 -> Plus
arm_3L 16382505..16382720 2886..3101 100 -> Plus
arm_3L 16380121..16382448 558..2885 100 -> Plus
arm_3L 16379726..16380056 227..557 100 -> Plus
arm_3L 16379445..16379670 1..226 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:46:39 Download gff for LD37257.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16383402..16383826 3550..3974 100   Plus
3L 16383036..16383284 3301..3549 100 -> Plus
3L 16382779..16382977 3102..3300 100 -> Plus
3L 16382505..16382720 2886..3101 100 -> Plus
3L 16380121..16382448 558..2885 100 -> Plus
3L 16379726..16380056 227..557 100 -> Plus
3L 16379445..16379670 1..226 100 -> Plus

LD37257.pep Sequence

Translation from 237 to 3590

> LD37257.pep
MSNEIYDSSNSQLSSDEYSHEEEEYDALMDAAVSKQRPQKTKSKGSESEK
PGNGAPESAAATEKNEKPDDDAVPPSTRSETIRRIRQLQLQRGRLPNLYF
KRRSIRWLRPNKMDYNSYFDGLKDLLPKRKLKHLVRFHDRQRRTYDSRSI
SRSRSHSRSLSRSCSRSRSRSYSRSRSGSGSPELICLDDTENEDSPEKPE
QEPARVTPIKENKPTLPAPPQLNYELPERKKANPLGNNENGASILDEFLV
KKDPQEPVFDYGKLSACRELEQALKDRSRDAPNEAESLVVDATLKRRRSV
TPPASEEKRNNEVEDDNIIGFSTVQQQKPMEAAPPLNLRMPTTPSTNPLQ
RQQAFKLSTPYTLAPPTAAKQADTYSLNTPPPTATQMQISYPNEKLSNNM
KANATFSIQQTALSQVAASYAAAPQVAALAQRAPSQVAPLQQAPVQQMHF
PRSVPPQQLPPPQQRAPPQQLATAPFAPPRHLAQHRPSPQQLAPSQQLAP
PHQLAPPHQLAPPQQRAPPQQLAPPHQLAPPHQLAPPQQRAPPQQLAPPQ
QLAPPQQLAPPQQLAPPQQLAPPQQRAPPQQRAPPQQLAPPQQRAPTQHM
APPQHMAPPQQLAPTQQLAPPPQQLAPRPQQLAPPPQQLAPPPQQLAPPP
QQPDSSRPASVQPLTPQRHASPHQLAQSQQVHQSPSQLHPVPVAAPNFAV
PQQPQPRRSETVSTQTQGLGSPAASSSTTRQKSFVDLNNSDANFHYRVKE
LFDELNSTMIDKINSVPPDEDSLKKERERIVADLAALDKLMAQKEDEYNR
LLYLSCIKKELHERMERKERLIRIKDLLPILINKCGTKELSEVKAMLEEE
IDSPMASKHSLSAIEKLLNYAELNQNIIQLLRGSLGLNKRAPSVSPANFE
DDQMLFRRDSLPVSHLSMRDQHYESRNAVNDHLLDSNPDRDPPAKRPKLI
HSQDSNQDMASSSTHLSANLSETLRKIRAWKNYSHFSNVSMEDNNSDNES
QIEPLFNSSPMASRRQLANRQSYQEQHSANINDHENVQKRHKSHKRKSHK
HKSHKHRSSHKSQAESSATINGNTGRQCHECKLYGATFMCSNCQNQWYCS
RECQLSDWDTHHRTCGI*

LD37257.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 11:02:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24275-PA 946 GF24275-PA 374..943 492..1115 692 35.3 Plus
Dana\GF24275-PA 946 GF24275-PA 6..548 9..530 493 38.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 11:03:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16002-PA 988 GG16002-PA 1..560 1..570 1733 72.6 Plus
Dere\GG16002-PA 988 GG16002-PA 317..988 467..1117 1653 57 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 11:03:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15890-PA 961 GH15890-PA 553..706 738..887 380 48.1 Plus
Dgri\GH15890-PA 961 GH15890-PA 1..456 1..421 308 31.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:02:55
Subject Length Description Subject Range Query Range Score Percent Strand
RAF2-PC 1117 CG4877-PC 1..1117 1..1117 5855 100 Plus
RAF2-PA 1117 CG4877-PA 1..1117 1..1117 5855 100 Plus
RAF2-PB 1117 CG4877-PB 1..1117 1..1117 5855 100 Plus
Wnk-PN 2441 CG7177-PN 1027..1443 324..711 295 29.1 Plus
Wnk-PL 2441 CG7177-PL 1027..1443 324..711 295 29.1 Plus
Wnk-PN 2441 CG7177-PN 794..1370 244..717 258 27 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 11:03:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16542-PA 931 GI16542-PA 534..929 726..1115 564 34.3 Plus
Dmoj\GI16542-PA 931 GI16542-PA 5..109 4..106 217 49.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 11:03:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17860-PA 1061 GL17860-PA 635..1060 697..1116 506 33.9 Plus
Dper\GL17860-PA 1061 GL17860-PA 1..345 1..309 327 41.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 11:03:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28518-PA 1024 GA28518-PA 594..1023 698..1116 511 34.7 Plus
Dpse\GA28518-PA 1024 GA28518-PA 1..343 1..309 341 41.2 Plus
Dpse\GA19696-PB 568 GA19696-PB 198..308 492..602 188 43.2 Plus
Dpse\GA19696-PB 568 GA19696-PB 199..302 517..620 187 43.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 11:03:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25634-PA 1045 GM25634-PA 1..501 1..505 1835 85.3 Plus
Dsec\GM25634-PA 1045 GM25634-PA 568..1045 635..1117 1761 79.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 11:03:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14638-PA 1041 GD14638-PA 525..1041 591..1117 1974 79.7 Plus
Dsim\GD14638-PA 1041 GD14638-PA 1..627 1..587 1909 76.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 11:03:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12793-PA 964 GJ12793-PA 540..962 708..1115 670 38.6 Plus
Dvir\GJ12793-PA 964 GJ12793-PA 1..466 1..404 410 35.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 11:03:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14586-PA 971 GK14586-PA 505..970 692..1116 670 36.5 Plus
Dwil\GK14586-PA 971 GK14586-PA 1..471 1..392 169 31.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 11:03:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23096-PA 1003 GE23096-PA 348..1003 488..1117 1780 58.6 Plus
Dyak\GE23096-PA 1003 GE23096-PA 1..572 1..564 1738 73 Plus
Dyak\GE19565-PA 153 GE19565-PA 1..153 959..1117 543 66.5 Plus

LD37257.hyp Sequence

Translation from 237 to 3590

> LD37257.hyp
MSNEIYDSSNSQLSSDEYSHEEEEYDALMDAAVSKQRPQKTKSKGSESEK
PGNGAPESAAATEKNEKPDDDAVPPSTRSETIRRIRQLQLQRGRLPNLYF
KRRSIRWLRPNKMDYNSYFDGLKDLLPKRKLKHLVRFHDRQRRTYDSRSI
SRSRSHSRSLSRSCSRSRSRSYSRSRSGSGSPELICLDDTENEDSPEKPE
QEPARVTPIKENKPTLPAPPQLNYELPERKKANPLGNNENGASILDEFLV
KKDPQEPVFDYGKLSACRELEQALKDRSRDAPNEAESLVVDATLKRRRSV
TPPASEEKRNNEVEDDNIIGFSTVQQQKPMEAAPPLNLRMPTTPSTNPLQ
RQQAFKLSTPYTLAPPTAAKQADTYSLNTPPPTATQMQISYPNEKLSNNM
KANATFSIQQTALSQVAASYAAAPQVAALAQRAPSQVAPLQQAPVQQMHF
PRSVPPQQLPPPQQRAPPQQLATAPFAPPRHLAQHRPSPQQLAPSQQLAP
PHQLAPPHQLAPPQQRAPPQQLAPPHQLAPPHQLAPPQQRAPPQQLAPPQ
QLAPPQQLAPPQQLAPPQQLAPPQQRAPPQQRAPPQQLAPPQQRAPTQHM
APPQHMAPPQQLAPTQQLAPPPQQLAPRPQQLAPPPQQLAPPPQQLAPPP
QQPDSSRPASVQPLTPQRHASPHQLAQSQQVHQSPSQLHPVPVAAPNFAV
PQQPQPRRSETVSTQTQGLGSPAASSSTTRQKSFVDLNNSDANFHYRVKE
LFDELNSTMIDKINSVPPDEDSLKKERERIVADLAALDKLMAQKEDEYNR
LLYLSCIKKELHERMERKERLIRIKDLLPILINKCGTKELSEVKAMLEEE
IDSPMASKHSLSAIEKLLNYAELNQNIIQLLRGSLGLNKRAPSVSPANFE
DDQMLFRRDSLPVSHLSMRDQHYESRNAVNDHLLDSNPDRDPPAKRPKLI
HSQDSNQDMASSSTHLSANLSETLRKIRAWKNYSHFSNVSMEDNNSDNES
QIEPLFNSSPMASRRQLANRQSYQEQHSANINDHENVQKRHKSHKRKSHK
HKSHKHRSSHKSQAESSATINGNTGRQCHECKLYGATFMCSNCQNQWYCS
RECQLSDWDTHHRTCGI*

LD37257.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:18:45
Subject Length Description Subject Range Query Range Score Percent Strand
RAF2-PC 1117 CG4877-PC 1..1117 1..1117 5855 100 Plus
RAF2-PA 1117 CG4877-PA 1..1117 1..1117 5855 100 Plus
RAF2-PB 1117 CG4877-PB 1..1117 1..1117 5855 100 Plus
Wnk-PN 2441 CG7177-PN 1027..1443 324..711 295 29.1 Plus
Wnk-PL 2441 CG7177-PL 1027..1443 324..711 295 29.1 Plus
Wnk-PN 2441 CG7177-PN 794..1370 244..717 258 27 Plus