Clone LD38259 Report

Search the DGRC for LD38259

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:382
Well:59
Vector:pOT2
Associated Gene/TranscriptMio-RI
Protein status:LD38259.pep: gold
Preliminary Size:5368
Sequenced Size:4770

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18362 2001-01-01 Release 2 assignment
CG18362 2001-07-04 Blastp of sequenced clone
CG18362 2003-01-01 Sim4 clustering to Release 3
Mio 2008-04-29 Release 5.5 accounting
Mio 2008-08-15 Release 5.9 accounting
Mio 2008-12-18 5.12 accounting

Clone Sequence Records

LD38259.complete Sequence

4770 bp (4771 high quality bases) assembled on 2007-08-10

GenBank Submission: AY051894

> LD38259.complete
TAGAAGCTTTGTGTTGCGCGTGTGTGCGTGGTATTGGTAGTCCGTCGTGC
CTGCTAACTGCCCGTGTTTCTGCTATAGGGGGCAGTTGCAGTTGTACCGA
AATTGTGGTGCGCGTGCATGCGCGTGTATATGAGTGGGAACGGAAAAAGG
CAAAATGCAAAGGCAGCGCTGAGCCAGAGGTCAAAAGTGCAAACACAGAA
CTGCTTGTGGAGTGCATACTCTGGATGGCAAGGCCGAATGCCAGGAGTCA
AATCGACTGAGCTCCATATAGTAATAGTGGAGAGGGGGACAACATTGCTG
CCTGACATCTGCGCATATAGAAGAACACGTACATACATACATATACATAT
GTATGTACGTTTTCCTAGCTGATAAGCAACGCTAGCGAGGTAGGGAGAGA
GAGAGATTTCGCGTCAGCTGTTCATTGTTGTGTTGTGTGCGGCGCACAGG
TTATGTGCGTTTCGCAGCTTCGTTCTCCGATCAGTTCTGTTTGTGGAATG
AAACCGATCGTTCTGCGCTGGTTCTGCCCGCCTTGTTGGCCTTCCATCAG
ATCCGCGTGTGTTTACGAGTAGTTGGGGCTTCACTATCTGTTCAAGGAGC
TACAAGCGGCCACTGACGTCTCGTTCTGACGTCCGTATCCCCAGCCAACC
CCGCCGCGATTGTGTGTGTGTGTGTGTGTGCGAAAATTGTTGTTATTGTG
CTGTGTGACGCATATAACGGCAAAAGCGGGGCGTGTTTGCCATTAGAGAA
GCTTCGCTCCGGAAAAAGCAACAATTGGACAGGTGTCGATGACGAAAAGC
TGAAGGTGTCGGGCATTGTAAACAAATCAAAATCTTAAAACCGTGCTATG
TCTCTATCAAATAATCGCTTATTTTAGTAATTTAGTTAATAGAATGACAA
GGACAAACACTAGATGAGAGAATTAATAAATGTGTTAACCACGAGGCAAG
ACAAAACATATTTTTTTTTATAGTCTGCGAACGTTTACATATTTTGAAAT
GATGGAAAAACCCCATCCAAATTAAAAAAGGGTCAGCACCAGCTTTTAAA
AGCCTTTACTACGCGAGAGACATTAAAAAACCATTAAATGTGCCCTCGCC
ATATCGACATAATCTGCAACCGCCAAAATTTTGGCTCAACAGTAAACTAT
TTGCATAGGCATCCCCTGGCACCTGTTGAAAATGATGCTGAATAAACACG
AGGGATACCAACGCACAAGCCAAATGTTTCCCCACCAGCAGCACCAGCTG
CCTCAGCTGCACCAGCAGCCTTATCTGCAACAGTCTCTGTGCCAAAACTT
CCAGCAATTGCAGTACGAAACGGGAGTAGGTGCTTCGGCGTCAGGGTCCG
CCGAGGCTACGGCAGACCTGCTCAAGGCGGAGCGGGAGTCTATCCACTCC
GGCCAGTTTATGGTCTCGCACTTCGAGGCAGAGGAGGCGCAGGACGACCT
AGAGGATGACGGCGAGGTGAAGATGCTAGACCCTGAGGACCCCGGTCTGG
GCAAGCCGGGCGAGCCAACCAACACATGTCGTGACGTGCAGCTTTACGTA
CCCCAAACAGTGGCCCACTTCAGCGCCATGGACCAGGAGGGCGACGAGAG
CAGCATGAGCATGGTGACCTCCCACCTGGAGATAGAGACCTCGCTCACCA
AACTCTTCAAGTGCATGAATCTGGCCTACAGTCAAAAACTAACCTCACCC
AAATGGAATCATTTCAAAGGAGTACGACTTCGGTGGAAGGACAAAATTCG
CCTGAACAATGTCATCTGGCGTTGCTGGCACATGCAGTTCATACAAAAGC
GCAGAACCCCGGTGTGTCAATTTGCGTCGCCGCTGGACGTTGATATACAT
AGTAATCCTCAAACTGTTGTTCTTGAAGGCAAATACTGGAAACGGCACTC
AGCTGTTATAAAAGCCGAATACAGGAAATGGCGCAGGAACTATAGGTCGA
AGGCTACGGGCTGCTTAACATATGATTCGAAAAGCGAATTAGACTTTTTG
GAATGGTCGCCTCTGAACGATAGGAACTTAATGCCAGACGATTGGACCAC
AGACACCTTATTCTCGGCTATAAACGTTCCATTCCCATTTCCAGATTCTA
GGGAAATCGCACGCGGCGCGGGCATCGCGGACTTTATACAGCCCAGTCTT
GGTCCCTTGCAACCGAATTTAGATGACATCGACATTAGCTTTTCAGACTT
GATTCCAACCACACGCTTGCCTCCAGTTCCAGAAGAGGGAACCGACGCTG
AAATGCTCAAAAACGACGAATATTGCCTGTCAGCGATTGTCGGTGCTCCT
CATACGCTGTATTGCAACGATAGCATAATGGATGTGGTAAACAGCAGTAA
CAATGGCGCTGTAAATGTAGATGCTAGCATGCTTGAGCTTAACACGCCCA
TAAATAACGTATCGTACGGTGAGGTAGAGCAACGATTTTCTGTTGCACGG
CAGGTGCAGCAATCCAACAATGATTCTCAGCTTCTCGGAGACTCGGGTTC
AATGTCCGGACGAATACACGGAGGCAAGCATTTTGGACCTGCTAGCGCAA
ACGACAACAACACCAATAGGTGTGTTATAAACGGTCGCGTGGCCAAGAGC
ACTCAGCGGCCATTCCGACGCGAGCCCCACAATTATGACAAGGCCCAGCC
CACAATGCACCAGACGAACCTGTATCAGCAAATGTTGGCCGAACAACAGA
AGAACCAGCAGCAGCAACACGTGGTAGTGTCTTCATTTCAGGCTTCCCAA
CAACAGCAGCTCGCTCAACAGCAACCCTTTTCGGCCCAGGCAACAAACGC
CTTCAATAATCAGAGTTTTATTAGCAGTTACGCAGATAACTATCAGCATC
AGCAGCAACTCAACGTCAAGGTAGAACCTCTACATGCCGATGTGCTGTCA
TTACTAAACGACAATGCATACAACTCTATTGGCTACAAGCCCTATCCGCA
ATTTAAGAAGTCCGCCTCGACGGGAACTTTTCTTAATGTCCCCAGGCAGA
CGCAGCAGCAGCAAAGTTATCTGCAGCAAGAGCCCCCGCAAATGCAACAG
TCCCTTCCCGTAGGCATGGGAAATCAACAAATTTTGCAGCTTACGCGTCA
GCAGCAGGTTAACAATACACAGCAACAGCAGCACCAATCCACAGTGGCTA
GCTTGTTGCAGCAGCAGCACCAGCAGCAAAACCATCAGCAACAGCAACTA
CAGACTGCTGTCAGCTCAGCCACATGGGTTTCGCCAAACACCATTTTGCC
TAAAGAAATCTACCGCTCCAACAGCTTACCACTGAATGTTTCCCTTAATA
AACTACCCGATGGTCGCCAGCTGCATCATGAGCAGCCCTTCGCAGTGCCC
AAGTATCACTCCAAAAGCAAGTCGAGGGTGCGGAGTAATTCGATGCACCA
GCAACACACTTCAGTGGTGTCTGCTGCTGGAGCGGGAAGTTCTTCATTAG
GCGCACATAGTTGCAGCAACCTGCTGGTCACTCAGCAAATGCAGCAGGCA
ACCAGCGATCCCATGCTAAACAGCACCCTGGCTCAACTGCTCACTTCGAA
TTCACGCCTACAAACAGCAGTGGCGAACAGTTCGTCATCAAATTCACCTT
CCGTCAGTGCCATAGCCACCACTAACAGCAACAGCAATGCGCCTCCGGTT
CATTACGCTAACGTCACATCGCCGTTGTCGGTTCCGGTGCCAACACATCA
ACACTCACCAAAAAAGTCCGCCTCCTTGCCTATGGCTGTCAACTCTGCAT
TGCACAGTCCCCCTCTAGGAAGTAAAATACACGGTATTGGGCTGGCCACA
GCTAACGTGGGCAGTAATAGCTTGAGTTTGTCACCGGAATCGACGTTCCA
CGAGTCACAGGATTCCCCACTGTCTCCTACAACCAGCCTAAAATTCCAGC
CGCGAGACACGCAGCGTCGTGCTGGCCATATCCACGCCGAGCAGAAGCGG
CGTTACAACATAAAGAACGGATTTGACACTCTGCACGCGCTCATACCACA
GCTTCAGCTAAATCCCAACGCCAAGTTAAGTAAGGCAGCCATGCTACAAA
AGGGAGCGGACCACATAAAGCAACTGCGACAGGAGCGCAATGTTTTAAAG
GATAAAATTGAAGCTTTGCGCATGGAGCGAGACGAGCTAAACAATTCGCT
GACGCACCTTCACTCAATTTTGCCAGCTAATGGAGCGCCTGTAACGAGGC
AGGGTACAGAACATGTTCGGCAGCTTTACGACATTTATGTACGATACAAT
ACAATGAACGACTGGAAATTTTGGATTTTGGGTCTCATTCTGGAACCTTT
GCTTGCCTCTTACACGTCAACAGTCTCGAGTGCTAGTCTTGATGAGCTAC
GTCGGACCGCTTTTCTTTGGGTTGATCAGCACTGTTCCCTTATTGATCTT
CGTCCAGCTGTTACAAATAAATTAAAGTATCTATCTATGCATACGGATAT
TGTTTCGGAGCCACCAAGTACATTGCAAGAGGAGGTGGCCAAAGCCCTCC
AGAATTCAAGTGGCCAGCATCCAAATCTGCATGGACCCTAACCGTTGATG
CTGATGTCCTTGATATGAATTTATTTAATTCAATCTTTATTTTAACAAAT
AATTTTTGCTAACTGCTCAGCACTAATTGTACAAAATGCCTGATGAGCAT
ATTTTTATACAAGAAATGGGCAACCGGCAACCAATAAATACGCAAAGCAG
CAATTAGTGCCTAGATTCTTGACTTAAGCGTATAATAAACTAACGATTTT
ACAAAAAAAAAAAAAAAAAA

LD38259.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:22:53
Subject Length Description Subject Range Query Range Score Percent Strand
dmondo-RF 5108 dmondo-RF 254..5007 1..4754 23770 100 Plus
dmondo-RI 4355 dmondo-RI 483..4353 884..4754 19355 100 Plus
dmondo.c 4677 dmondo.c 70..3746 1..3677 18370 99.9 Plus
dmondo.c 4677 dmondo.c 3743..4676 3821..4754 4670 100 Plus
dmondo-RI 4355 dmondo-RI 96..484 1..389 1945 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:50:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 21306787..21308464 1681..1 8200 99.5 Minus
chr2L 23010047 chr2L 21286553..21287912 3549..2190 6770 99.9 Minus
chr2L 23010047 chr2L 21285891..21286495 4154..3550 3010 99.8 Minus
chr2L 23010047 chr2L 21284585..21284931 4752..4406 1735 100 Minus
chr2L 23010047 chr2L 21288116..21288246 2109..1979 655 100 Minus
chr2L 23010047 chr2L 21284993..21285122 4407..4278 650 100 Minus
chr2L 23010047 chr2L 21285705..21285828 4277..4154 620 100 Minus
chr2L 23010047 chr2L 21296197..21296313 1979..1863 585 100 Minus
chr2L 23010047 chr2L 21303325..21303436 1788..1677 560 100 Minus
chr2L 23010047 chr2L 21287963..21288050 2196..2109 440 100 Minus
chr2L 23010047 chr2L 21299954..21300027 1862..1789 370 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:50:28
Subject Length Description Subject Range Query Range Score Percent Strand
Mio-RM 3360 CG18362-PM 1..3360 1182..4541 16800 100 Plus
Mio-RL 3360 CG18362-PL 1..3360 1182..4541 16800 100 Plus
Mio-RK 3360 CG18362-PK 1..3360 1182..4541 16800 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:32:58 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:50:27
Subject Length Description Subject Range Query Range Score Percent Strand
Mio-RH 4837 CG18362-RH 83..4834 1..4752 23760 100 Plus
Mio-RF 4834 CG18362-RF 83..4834 1..4752 23760 100 Plus
Mio-RJ 4276 CG18362-RJ 1..4273 480..4752 21365 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:50:32
Subject Length Description Subject Range Query Range Score Percent Strand
Mio-PM 1119 CG18362-PM 1..1119 1182..4538 4542 100 Plus
Mio-PL 1119 CG18362-PL 1..1119 1182..4538 4542 100 Plus
Mio-PK 1119 CG18362-PK 1..1119 1182..4538 4542 100 Plus
Mio-PJ 1119 CG18362-PJ 1..1119 1182..4538 4542 100 Plus
Mio-PI 1119 CG18362-PI 1..1119 1182..4538 4542 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:50:22
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 21308288..21309968 1681..1 8405 100 Minus
2L 23513712 2L 21288052..21289411 3549..2190 6785 99.9 Minus
2L 23513712 2L 21287390..21287994 4154..3550 3025 100 Minus
2L 23513712 2L 21286079..21286427 4754..4406 1745 100 Minus
2L 23513712 2L 21289615..21289745 2109..1979 655 100 Minus
2L 23513712 2L 21286489..21286618 4407..4278 650 100 Minus
2L 23513712 2L 21287204..21287327 4277..4154 620 100 Minus
2L 23513712 2L 21297695..21297811 1979..1863 585 100 Minus
2L 23513712 2L 21304825..21304936 1788..1677 560 100 Minus
2L 23513712 2L 21289462..21289549 2196..2109 440 100 Minus
2L 23513712 2L 21301454..21301527 1862..1789 370 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:09:53
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 21308288..21309968 1681..1 8405 100 Minus
2L 23513712 2L 21288052..21289411 3549..2190 6785 99.9 Minus
2L 23513712 2L 21287390..21287994 4154..3550 3025 100 Minus
2L 23513712 2L 21286079..21286427 4754..4406 1745 100 Minus
2L 23513712 2L 21289615..21289745 2109..1979 655 100 Minus
2L 23513712 2L 21286489..21286618 4407..4278 650 100 Minus
2L 23513712 2L 21287204..21287327 4277..4154 620 100 Minus
2L 23513712 2L 21297695..21297811 1979..1863 585 100 Minus
2L 23513712 2L 21304825..21304936 1788..1677 560 100 Minus
2L 23513712 2L 21289462..21289549 2196..2109 440 100 Minus
2L 23513712 2L 21301454..21301527 1862..1789 370 100 Minus
Blast to na_te.dros performed 2014-11-26 19:50:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2348..2546 2996..3200 245 61.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2304..2824 2655..3224 223 56.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6755..6961 3003..3212 203 59.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2578..2647 2647..2719 150 71.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6737..6864 2646..2773 135 58.1 Plus
roo 9092 roo DM_ROO 9092bp 1063..1186 2657..2784 134 59.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2248..2386 1174..1312 128 54.7 Plus
Dbuz\BuT4 1447 Dbuz\BuT4 BUT4 1447bp 323..422 425..325 124 60.8 Minus
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 581..622 308..349 120 76.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6727..6920 2657..2859 119 54.7 Plus

LD38259.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:28:42 Download gff for LD38259.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 21306787..21308464 1..1681 98   Minus
chr2L 21303325..21303431 1682..1788 100 <- Minus
chr2L 21299954..21300027 1789..1862 100 <- Minus
chr2L 21296197..21296313 1863..1979 100 <- Minus
chr2L 21288116..21288245 1980..2109 100 <- Minus
chr2L 21287963..21288049 2110..2196 100 <- Minus
chr2L 21287004..21287905 2197..3098 99 <- Minus
chr2L 21286553..21286898 3204..3549 100 == Minus
chr2L 21285892..21286495 3550..4153 99 <- Minus
chr2L 21285705..21285828 4154..4277 100 <- Minus
chr2L 21284993..21285122 4278..4407 100 <- Minus
chr2L 21284585..21284929 4408..4752 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:52:50 Download gff for LD38259.complete
Subject Subject Range Query Range Percent Splice Strand
Mio-RA 1..3360 1182..4541 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:46:59 Download gff for LD38259.complete
Subject Subject Range Query Range Percent Splice Strand
Mio-RF 1..3360 1182..4541 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:54:58 Download gff for LD38259.complete
Subject Subject Range Query Range Percent Splice Strand
Mio-RK 1..3360 1182..4541 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:41:06 Download gff for LD38259.complete
Subject Subject Range Query Range Percent Splice Strand
Mio-RA 1..3360 1182..4541 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:28:42 Download gff for LD38259.complete
Subject Subject Range Query Range Percent Splice Strand
Mio-RK 1..3360 1182..4541 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:52:50 Download gff for LD38259.complete
Subject Subject Range Query Range Percent Splice Strand
Mio-RB 426..4229 949..4752 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:46:58 Download gff for LD38259.complete
Subject Subject Range Query Range Percent Splice Strand
Mio-RF 1..4752 1..4752 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:54:58 Download gff for LD38259.complete
Subject Subject Range Query Range Percent Splice Strand
Mio-RF 83..4834 1..4752 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:41:07 Download gff for LD38259.complete
Subject Subject Range Query Range Percent Splice Strand
Mio-RB 426..4229 949..4752 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:28:42 Download gff for LD38259.complete
Subject Subject Range Query Range Percent Splice Strand
Mio-RF 83..4834 1..4752 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:28:42 Download gff for LD38259.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21308288..21309968 1..1681 100   Minus
2L 21304825..21304931 1682..1788 100 <- Minus
2L 21301454..21301527 1789..1862 100 <- Minus
2L 21297695..21297811 1863..1979 100 <- Minus
2L 21289615..21289744 1980..2109 100 <- Minus
2L 21289462..21289548 2110..2196 100 <- Minus
2L 21288052..21289404 2197..3549 100 <- Minus
2L 21287391..21287994 3550..4153 100 <- Minus
2L 21287204..21287327 4154..4277 100 <- Minus
2L 21286489..21286618 4278..4407 100 <- Minus
2L 21286081..21286425 4408..4752 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:54:58 Download gff for LD38259.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 21308288..21309968 1..1681 100   Minus
arm_2L 21304825..21304931 1682..1788 100 <- Minus
arm_2L 21301454..21301527 1789..1862 100 <- Minus
arm_2L 21297695..21297811 1863..1979 100 <- Minus
arm_2L 21289615..21289744 1980..2109 100 <- Minus
arm_2L 21289462..21289548 2110..2196 100 <- Minus
arm_2L 21288052..21289404 2197..3549 100 <- Minus
arm_2L 21287391..21287994 3550..4153 100 <- Minus
arm_2L 21287204..21287327 4154..4277 100 <- Minus
arm_2L 21286489..21286618 4278..4407 100 <- Minus
arm_2L 21286081..21286425 4408..4752 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:32:42 Download gff for LD38259.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21308288..21309968 1..1681 100   Minus
2L 21304825..21304931 1682..1788 100 <- Minus
2L 21301454..21301527 1789..1862 100 <- Minus
2L 21297695..21297811 1863..1979 100 <- Minus
2L 21289615..21289744 1980..2109 100 <- Minus
2L 21289462..21289548 2110..2196 100 <- Minus
2L 21288052..21289404 2197..3549 100 <- Minus
2L 21287391..21287994 3550..4153 100 <- Minus
2L 21287204..21287327 4154..4277 100 <- Minus
2L 21286489..21286618 4278..4407 100 <- Minus
2L 21286081..21286425 4408..4752 100 <- Minus

LD38259.pep Sequence

Translation from 1181 to 4540

> LD38259.pep
MMLNKHEGYQRTSQMFPHQQHQLPQLHQQPYLQQSLCQNFQQLQYETGVG
ASASGSAEATADLLKAERESIHSGQFMVSHFEAEEAQDDLEDDGEVKMLD
PEDPGLGKPGEPTNTCRDVQLYVPQTVAHFSAMDQEGDESSMSMVTSHLE
IETSLTKLFKCMNLAYSQKLTSPKWNHFKGVRLRWKDKIRLNNVIWRCWH
MQFIQKRRTPVCQFASPLDVDIHSNPQTVVLEGKYWKRHSAVIKAEYRKW
RRNYRSKATGCLTYDSKSELDFLEWSPLNDRNLMPDDWTTDTLFSAINVP
FPFPDSREIARGAGIADFIQPSLGPLQPNLDDIDISFSDLIPTTRLPPVP
EEGTDAEMLKNDEYCLSAIVGAPHTLYCNDSIMDVVNSSNNGAVNVDASM
LELNTPINNVSYGEVEQRFSVARQVQQSNNDSQLLGDSGSMSGRIHGGKH
FGPASANDNNTNRCVINGRVAKSTQRPFRREPHNYDKAQPTMHQTNLYQQ
MLAEQQKNQQQQHVVVSSFQASQQQQLAQQQPFSAQATNAFNNQSFISSY
ADNYQHQQQLNVKVEPLHADVLSLLNDNAYNSIGYKPYPQFKKSASTGTF
LNVPRQTQQQQSYLQQEPPQMQQSLPVGMGNQQILQLTRQQQVNNTQQQQ
HQSTVASLLQQQHQQQNHQQQQLQTAVSSATWVSPNTILPKEIYRSNSLP
LNVSLNKLPDGRQLHHEQPFAVPKYHSKSKSRVRSNSMHQQHTSVVSAAG
AGSSSLGAHSCSNLLVTQQMQQATSDPMLNSTLAQLLTSNSRLQTAVANS
SSSNSPSVSAIATTNSNSNAPPVHYANVTSPLSVPVPTHQHSPKKSASLP
MAVNSALHSPPLGSKIHGIGLATANVGSNSLSLSPESTFHESQDSPLSPT
TSLKFQPRDTQRRAGHIHAEQKRRYNIKNGFDTLHALIPQLQLNPNAKLS
KAAMLQKGADHIKQLRQERNVLKDKIEALRMERDELNNSLTHLHSILPAN
GAPVTRQGTEHVRQLYDIYVRYNTMNDWKFWILGLILEPLLASYTSTVSS
ASLDELRRTAFLWVDQHCSLIDLRPAVTNKLKYLSMHTDIVSEPPSTLQE
EVAKALQNSSGQHPNLHGP*

LD38259.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 21:51:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15566-PA 1160 GF15566-PA 1..1160 1..1118 4440 80.1 Plus
Dana\GF18714-PA 254 GF18714-PA 64..229 901..1081 166 28.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 21:51:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21509-PA 1071 GG21509-PA 1..1071 1..1119 4958 91.8 Plus
Dere\GG12119-PA 254 GG12119-PA 64..251 901..1112 169 26.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 21:51:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13021-PA 1238 GH13021-PA 1..1237 1..1118 3700 66.1 Plus
Dgri\GH23834-PA 263 GH23834-PA 36..232 884..1085 161 27.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 21:51:35
Subject Length Description Subject Range Query Range Score Percent Strand
Mio-PM 1119 CG18362-PM 1..1119 1..1119 5846 100 Plus
Mio-PL 1119 CG18362-PL 1..1119 1..1119 5846 100 Plus
Mio-PK 1119 CG18362-PK 1..1119 1..1119 5846 100 Plus
Mio-PJ 1119 CG18362-PJ 1..1119 1..1119 5846 100 Plus
Mio-PI 1119 CG18362-PI 1..1119 1..1119 5846 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 21:51:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17432-PA 1075 GI17432-PA 1..1074 1..1118 3469 65.7 Plus
Dmoj\GI24571-PA 254 GI24571-PA 72..251 911..1112 167 27.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 21:51:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26357-PA 1125 GL26357-PA 1..1124 1..1118 4054 74.4 Plus
Dper\GL23593-PA 251 GL23593-PA 58..230 898..1085 170 27.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 21:52:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14905-PA 1110 GA14905-PA 1..1109 1..1118 4066 75.2 Plus
Dpse\GA17397-PA 251 GA17397-PA 58..230 898..1085 170 27.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 21:52:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23262-PA 1116 GM23262-PA 1..1116 1..1119 5243 96.4 Plus
Dsec\GM10111-PA 254 GM10111-PA 61..233 898..1085 172 27.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 21:52:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21641-PA 451 GD21641-PA 1..451 621..1119 1904 85.4 Plus
Dsim\GD21642-PA 258 GD21642-PA 1..238 284..521 1207 96.2 Plus
Dsim\GD21640-PA 212 GD21640-PA 1..199 1..202 979 96.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 21:52:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18379-PA 1181 GJ18379-PA 945..1180 885..1118 1195 94.1 Plus
Dvir\GJ22637-PA 252 GJ22637-PA 55..249 893..1112 179 26.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 21:52:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18680-PA 1168 GK18680-PA 43..1167 34..1118 4053 76.6 Plus
Dwil\GK11114-PA 246 GK11114-PA 55..224 901..1085 166 28.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 21:52:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12990-PA 1071 GE12990-PA 1..1071 1..1119 4844 90.7 Plus
Dyak\GE10568-PA 254 GE10568-PA 61..251 898..1112 167 25.9 Plus

LD38259.hyp Sequence

Translation from 1181 to 4540

> LD38259.hyp
MMLNKHEGYQRTSQMFPHQQHQLPQLHQQPYLQQSLCQNFQQLQYETGVG
ASASGSAEATADLLKAERESIHSGQFMVSHFEAEEAQDDLEDDGEVKMLD
PEDPGLGKPGEPTNTCRDVQLYVPQTVAHFSAMDQEGDESSMSMVTSHLE
IETSLTKLFKCMNLAYSQKLTSPKWNHFKGVRLRWKDKIRLNNVIWRCWH
MQFIQKRRTPVCQFASPLDVDIHSNPQTVVLEGKYWKRHSAVIKAEYRKW
RRNYRSKATGCLTYDSKSELDFLEWSPLNDRNLMPDDWTTDTLFSAINVP
FPFPDSREIARGAGIADFIQPSLGPLQPNLDDIDISFSDLIPTTRLPPVP
EEGTDAEMLKNDEYCLSAIVGAPHTLYCNDSIMDVVNSSNNGAVNVDASM
LELNTPINNVSYGEVEQRFSVARQVQQSNNDSQLLGDSGSMSGRIHGGKH
FGPASANDNNTNRCVINGRVAKSTQRPFRREPHNYDKAQPTMHQTNLYQQ
MLAEQQKNQQQQHVVVSSFQASQQQQLAQQQPFSAQATNAFNNQSFISSY
ADNYQHQQQLNVKVEPLHADVLSLLNDNAYNSIGYKPYPQFKKSASTGTF
LNVPRQTQQQQSYLQQEPPQMQQSLPVGMGNQQILQLTRQQQVNNTQQQQ
HQSTVASLLQQQHQQQNHQQQQLQTAVSSATWVSPNTILPKEIYRSNSLP
LNVSLNKLPDGRQLHHEQPFAVPKYHSKSKSRVRSNSMHQQHTSVVSAAG
AGSSSLGAHSCSNLLVTQQMQQATSDPMLNSTLAQLLTSNSRLQTAVANS
SSSNSPSVSAIATTNSNSNAPPVHYANVTSPLSVPVPTHQHSPKKSASLP
MAVNSALHSPPLGSKIHGIGLATANVGSNSLSLSPESTFHESQDSPLSPT
TSLKFQPRDTQRRAGHIHAEQKRRYNIKNGFDTLHALIPQLQLNPNAKLS
KAAMLQKGADHIKQLRQERNVLKDKIEALRMERDELNNSLTHLHSILPAN
GAPVTRQGTEHVRQLYDIYVRYNTMNDWKFWILGLILEPLLASYTSTVSS
ASLDELRRTAFLWVDQHCSLIDLRPAVTNKLKYLSMHTDIVSEPPSTLQE
EVAKALQNSSGQHPNLHGP*

LD38259.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:52:05
Subject Length Description Subject Range Query Range Score Percent Strand
Mio-PM 1119 CG18362-PM 1..1119 1..1119 5846 100 Plus
Mio-PL 1119 CG18362-PL 1..1119 1..1119 5846 100 Plus
Mio-PK 1119 CG18362-PK 1..1119 1..1119 5846 100 Plus
Mio-PJ 1119 CG18362-PJ 1..1119 1..1119 5846 100 Plus
Mio-PI 1119 CG18362-PI 1..1119 1..1119 5846 100 Plus