Clone LD38389 Report

Search the DGRC for LD38389

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:383
Well:89
Vector:pOT2
Associated Gene/TranscriptProsalpha7-RA
Protein status:LD38389.pep: gold
Preliminary Size:1140
Sequenced Size:997

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1519 2001-01-01 Release 2 assignment
CG1519 2001-11-09 Blastp of sequenced clone
CG1519 2003-01-01 Sim4 clustering to Release 3
Prosalpha7 2008-04-29 Release 5.5 accounting
Prosalpha7 2008-08-15 Release 5.9 accounting
Prosalpha7 2008-12-18 5.12 accounting

Clone Sequence Records

LD38389.complete Sequence

997 bp (997 high quality bases) assembled on 2001-11-09

GenBank Submission: AY069616

> LD38389.complete
CCAAGTAAAAGCCGTCAAATCATCGTCGCATTCGACCCAAGGAATTAAAC
TAATTTTTGCGTTTGAATTGTTTAAATTTTCACAAAGTCTTCGCTATGAG
TACTATTGGCACTGGATACGACTTGTCGGCCTCGCAGTTTTCGCCTGATG
GCCGCGTTTTCCAGATCGACTACGCCTCAAAGGCGGTGGAGAAGAGCGGC
ACCGTAATCGGGATTCGGGGCAAGGACGCCGTGGTGCTGGCCGTGGAGAA
GATCATCACCAGTAAACTGTACGAACCAGACGCCGGCGGACGCATCTTCA
CCATCGAAAAGAACATCGGAATGGCGGTGGCCGGCTTGGTGGCCGATGGA
AACTTTGTGGCTGACATTGCGCGTCAGGAGGCAGCCAACTACAGACAGCA
ATTTGAGCAGGCTATCCCGCTTAAACACCTGTGCCACCGAGTCGCCGGCT
ACGTTCACGCCTACACTCTGTACAGTGCCGTCCGCCCCTTCGGACTTTCC
ATCATTCTCGCCTCCTGGGACGAAGTAGAGGGGCCACAGCTCTACAAGAT
CGAGCCGTCCGGCTCCTCCTTCGGTTACTTCGCCTGCGCCAGCGGCAAGG
CCAAGCAGCTGGCCAAGACTGAGATGGAGAAGCTCAAGATGGATATGAGG
ACCGACGAATTGGTGGAGAGCGCTGGTGAAATCATCTACAAAGTCCATGA
CGAGTTGAAGGACAAGGACTTCCGCTTCGAAATGGGTTTGGTGGGCAGGG
TAACCGGTGGCCTACATCTCATAAATCCCTCAGAACTGACGGAGAAGGCG
AGGAAAGCCGGCGATGCGGCCAACAAGGACGAAGACAGCGACAATGAGAC
GCACTAGTTCGTTTGTGTGCCAGTGAATCTAATTCTGGGCCTCATACATA
ATGTTAATTTTATATTTCCCTAAAGCGCAAAATGAATAAACAAAATCGGG
TGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

LD38389.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:00:30
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha7-RA 1037 Prosalpha7-RA 48..1002 1..955 4775 100 Plus
Prosalpha7.a 967 Prosalpha7.a 23..704 1..682 3410 100 Plus
Prosalpha7.a 967 Prosalpha7.a 701..966 690..955 1315 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 10:55:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5734552..5735117 682..117 2830 100 Minus
chr2R 21145070 chr2R 5734115..5734384 952..683 1350 100 Minus
chr2R 21145070 chr2R 5735176..5735291 116..1 580 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:55:37
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha7-RA 762 CG1519-PA 1..762 96..857 3810 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:33:06 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:55:37
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha7-RA 976 CG1519-RA 25..976 1..952 4760 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 10:55:39
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha7-PA 253 CG1519-PA 1..253 96..854 1291 100 Plus
Prosalpha1-PB 244 CG18495-PB 8..242 114..815 317 30.5 Plus
Prosalpha1-PA 244 CG18495-PA 8..242 114..815 317 30.5 Plus
CG30382-PB 244 CG30382-PB 8..242 114..815 317 30.5 Plus
CG30382-PA 244 CG30382-PA 8..242 114..815 317 30.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:55:35
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9847073..9847638 682..117 2830 100 Minus
2R 25286936 2R 9846633..9846905 955..683 1365 100 Minus
2R 25286936 2R 9847697..9847812 116..1 580 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:25:22
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9848272..9848837 682..117 2830 100 Minus
2R 25260384 2R 9847832..9848104 955..683 1365 100 Minus
2R 25260384 2R 9848896..9849011 116..1 580 100 Minus
Blast to na_te.dros performed on 2014-11-27 10:55:36 has no hits.

LD38389.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 12:37:25 Download gff for LD38389.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5735176..5735291 1..116 100   Minus
chr2R 5734552..5735117 117..682 100 <- Minus
chr2R 5734115..5734384 683..952 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:20:39 Download gff for LD38389.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha7-RA 1..762 96..857 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:33:44 Download gff for LD38389.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha7-RA 1..762 96..857 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:21:49 Download gff for LD38389.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha7-RA 1..762 96..857 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:01:20 Download gff for LD38389.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha7-RA 1..762 96..857 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:37:25 Download gff for LD38389.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha7-RA 1..762 96..857 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:12:57 Download gff for LD38389.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha7-RA 23..974 1..952 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:33:44 Download gff for LD38389.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha7-RA 23..974 1..952 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:21:49 Download gff for LD38389.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha7-RA 25..976 1..952 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:01:20 Download gff for LD38389.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha7-RA 23..974 1..952 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:37:25 Download gff for LD38389.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha7-RA 25..976 1..952 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 12:37:25 Download gff for LD38389.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9847697..9847812 1..116 100   Minus
2R 9847073..9847638 117..682 100 <- Minus
2R 9846636..9846905 683..952 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:21:49 Download gff for LD38389.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5735202..5735317 1..116 100   Minus
arm_2R 5734578..5735143 117..682 100 <- Minus
arm_2R 5734141..5734410 683..952 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:38:11 Download gff for LD38389.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9848896..9849011 1..116 100   Minus
2R 9848272..9848837 117..682 100 <- Minus
2R 9847835..9848104 683..952 100 <- Minus

LD38389.pep Sequence

Translation from 95 to 856

> LD38389.pep
MSTIGTGYDLSASQFSPDGRVFQIDYASKAVEKSGTVIGIRGKDAVVLAV
EKIITSKLYEPDAGGRIFTIEKNIGMAVAGLVADGNFVADIARQEAANYR
QQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGLSIILASWDEVEGPQLY
KIEPSGSSFGYFACASGKAKQLAKTEMEKLKMDMRTDELVESAGEIIYKV
HDELKDKDFRFEMGLVGRVTGGLHLINPSELTEKARKAGDAANKDEDSDN
ETH*

LD38389.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 05:15:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13142-PA 253 GF13142-PA 1..253 1..253 1188 87.4 Plus
Dana\GF14761-PA 253 GF14761-PA 1..253 1..253 1094 77.9 Plus
Dana\GF11235-PA 244 GF11235-PA 8..242 7..240 321 31 Plus
Dana\GF11246-PA 252 GF11246-PA 5..176 8..179 311 34.9 Plus
Dana\GF19028-PA 249 GF19028-PA 1..176 4..179 296 34.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 05:15:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25255-PA 253 GG25255-PA 1..252 1..252 1243 93.3 Plus
Dere\GG10705-PA 244 GG10705-PA 8..242 7..240 306 29.8 Plus
Dere\GG15180-PA 251 GG15180-PA 1..190 4..196 301 33.7 Plus
Dere\GG18927-PA 234 GG18927-PA 6..191 8..193 295 35.8 Plus
Dere\GG17945-PA 249 GG17945-PA 1..176 4..179 288 33.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 05:15:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21325-PA 253 GH21325-PA 1..252 1..251 1074 79 Plus
Dgri\GH20588-PA 244 GH20588-PA 8..242 7..240 313 30.3 Plus
Dgri\GH13898-PA 234 GH13898-PA 6..191 8..193 300 35.8 Plus
Dgri\GH12557-PA 249 GH12557-PA 1..190 4..196 299 33.7 Plus
Dgri\GH20521-PA 263 GH20521-PA 5..223 8..222 294 31.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 05:15:27
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha7-PA 253 CG1519-PA 1..253 1..253 1291 100 Plus
Prosalpha1-PB 244 CG18495-PB 8..242 7..240 317 30.5 Plus
Prosalpha1-PA 244 CG18495-PA 8..242 7..240 317 30.5 Plus
CG30382-PB 244 CG30382-PB 8..242 7..240 317 30.5 Plus
CG30382-PA 244 CG30382-PA 8..242 7..240 317 30.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 05:15:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20743-PA 253 GI20743-PA 1..252 1..251 1104 81.3 Plus
Dmoj\GI19734-PA 244 GI19734-PA 8..242 7..240 310 30.1 Plus
Dmoj\GI16051-PA 247 GI16051-PA 13..233 15..234 307 33.6 Plus
Dmoj\GI24829-PA 234 GI24829-PA 6..191 8..193 300 35.8 Plus
Dmoj\GI21067-PA 263 GI21067-PA 5..223 8..222 292 31.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 05:15:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10238-PA 254 GL10238-PA 1..254 1..253 1119 83.1 Plus
Dper\GL14346-PA 265 GL14346-PA 7..263 8..253 447 38.5 Plus
Dper\GL22394-PA 246 GL22394-PA 5..245 8..241 320 33.6 Plus
Dper\GL17442-PA 244 GL17442-PA 8..242 7..240 318 30.3 Plus
Dper\GL20413-PA 252 GL20413-PA 5..176 8..179 298 33.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 05:15:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24133-PA 254 GA24133-PA 1..254 1..253 1119 83.1 Plus
Dpse\GA25966-PA 197 GA25966-PA 5..197 5..196 524 48.2 Plus
Dpse\GA22984-PA 265 GA22984-PA 7..263 8..253 441 38.1 Plus
Dpse\GA15805-PA 244 GA15805-PA 8..242 7..240 318 30.3 Plus
Dpse\GA28930-PA 246 GA28930-PA 5..245 8..241 317 33.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 05:15:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24383-PA 253 GM24383-PA 1..253 1..253 1318 98.4 Plus
Dsec\GM20573-PA 181 GM20573-PA 1..126 1..127 499 79.5 Plus
Dsec\GM20751-PA 244 GM20751-PA 8..242 7..240 312 30.5 Plus
Dsec\GM24033-PA 234 GM24033-PA 6..191 8..193 294 35.8 Plus
Dsec\Pros28.1B-PA 252 GM11825-PA 5..176 8..179 289 33.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 05:15:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10046-PA 253 GD10046-PA 1..253 1..253 1318 98.4 Plus
Dsim\GD10216-PA 244 GD10216-PA 8..242 7..240 312 30.5 Plus
Dsim\GD18834-PA 234 GD18834-PA 6..191 8..193 294 35.8 Plus
Dsim\Pros28.1A-PA 251 GD20037-PA 1..180 4..183 289 32.2 Plus
Dsim\Pros28.1B-PA 252 GD24946-PA 5..176 8..179 288 33.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 05:15:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20480-PA 252 GJ20480-PA 1..251 1..251 1052 79 Plus
Dvir\GJ18434-PA 244 GJ18434-PA 8..242 7..240 318 30.5 Plus
Dvir\GJ24473-PA 234 GJ24473-PA 6..191 8..193 299 35.3 Plus
Dvir\Pros28.1-PA 249 GJ18504-PA 1..190 4..196 298 33.7 Plus
Dvir\GJ21990-PA 263 GJ21990-PA 5..222 8..221 281 32 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 05:15:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20963-PA 256 GK20963-PA 1..253 1..251 1054 78.7 Plus
Dwil\GK21354-PA 244 GK21354-PA 8..242 7..240 314 29.7 Plus
Dwil\GK19681-PA 255 GK19681-PA 1..176 4..179 307 34.1 Plus
Dwil\GK14404-PA 234 GK14404-PA 6..191 8..193 301 36.4 Plus
Dwil\GK25669-PA 249 GK25669-PA 5..176 8..179 293 34.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 05:15:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21995-PA 253 GE21995-PA 1..252 1..252 1256 94 Plus
Dyak\GE23574-PA 244 GE23574-PA 8..242 7..240 320 30.7 Plus
Dyak\GE25043-PA 251 GE25043-PA 1..190 4..196 311 34.2 Plus
Dyak\GE26194-PA 234 GE26194-PA 6..191 8..193 300 36.4 Plus
Dyak\GE11446-PA 252 GE11446-PA 5..187 8..195 291 32.4 Plus

LD38389.hyp Sequence

Translation from 95 to 856

> LD38389.hyp
MSTIGTGYDLSASQFSPDGRVFQIDYASKAVEKSGTVIGIRGKDAVVLAV
EKIITSKLYEPDAGGRIFTIEKNIGMAVAGLVADGNFVADIARQEAANYR
QQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGLSIILASWDEVEGPQLY
KIEPSGSSFGYFACASGKAKQLAKTEMEKLKMDMRTDELVESAGEIIYKV
HDELKDKDFRFEMGLVGRVTGGLHLINPSELTEKARKAGDAANKDEDSDN
ETH*

LD38389.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:45:36
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha7-PA 253 CG1519-PA 1..253 1..253 1291 100 Plus
Prosalpha1-PB 244 CG18495-PB 8..242 7..240 317 30.5 Plus
Prosalpha1-PA 244 CG18495-PA 8..242 7..240 317 30.5 Plus
CG30382-PB 244 CG30382-PB 8..242 7..240 317 30.5 Plus
CG30382-PA 244 CG30382-PA 8..242 7..240 317 30.5 Plus