Clone LD39308 Report

Search the DGRC for LD39308

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:393
Well:8
Vector:pOT2
Associated Gene/Transcriptstck-RA
Protein status:LD39308.pep: gold
Preliminary Size:2899
Sequenced Size:2713

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7954 2001-01-01 Release 2 assignment
CG7954 2001-07-04 Blastp of sequenced clone
CG7954 2003-01-01 Sim4 clustering to Release 3
stck 2008-04-29 Release 5.5 accounting
stck 2008-08-15 Release 5.9 accounting
stck 2008-12-18 5.12 accounting

Clone Sequence Records

LD39308.complete Sequence

2713 bp (2713 high quality bases) assembled on 2001-07-04

GenBank Submission: AY060424

> LD39308.complete
TTAAATGAAAAGTAATTTAATTGCAGCAAACTGTGGCTTTAATTAAAAAG
GTTTCTCTGAAGGTAAAAAGTACTTTTTCCGTTGAATGCAATTCTTCAAA
TGTGAACATGCTTAAGTGAAACGCGTGAAATTCCAGAGATTTGCCCATTT
TGGCAATATAGGTGTTGTTGTTTTTGTGCTGCGATAGCGCTGCGCAGATC
GTCTTCTTGGCTGAAAATCAACCGGATCTGGCTAGAAGGCCGCCAAGCGA
GCAGAGCTTAAAGCCAAAAGACACAGATTGATCATTTCTATATGTTTTTG
CAGTGTTTCACTCGCCGTGATCAGAAAACGTTGTACACCAGGTGCAACAG
GTGCCGTTGTTCGCAAGTGAAAACCAGTTGAAAGCAACTAAAAAAGAAAA
GCCCACAGAATGCCGCCCGTGCAGTAAGCAGAATGTTCCGCCCCACTTTC
TTAACGTCCTTGTCTTCAAAACGCCCACATATTGCATCATTTGGCAGCAT
AATAATCATCGTTATCCATTCGCACAAATAAGCATTTCGCTAATTAATAA
AAAAATATAACTAATTCAGGCTAGCAGTGCCTATCATTCATGCCCTAATC
CAGCGTTAACCCTCTGCCAGTGATGGTGGTGCTTTGGACCCCCATTCAAT
GCAATTTTCCTGCCAGATGTTTACTCCATCGATGACGTCATGGTCATATT
CAAATTTATTTTTAAACGCCGCCACTCGAGTGTGTGTGTGTGTTTGTGCG
AGAGTGCGTGTCTGTGTATTGTTTACTCTTCGTATTTTTGTGTGTATTCG
TCGGATTTGATTATGATGAGTGGGCCGCTGTTGTGTTGGCGGCAAACCCA
ATTCCAATTGGATGCTTGAATTTGTAACCCCTTTTGGAGGCCAAGGAATG
TTCAATGACTCAACCAGTAATGGGGAGTTGATAGTTACATCTTATTATAT
ATATTGTTTATATACAAACTTTTCAAATGGCGCTCCTGCTTGTAATAATT
ACTTCAATTACTCATTATAGCCATTCATTGTTATCCAGCTTAAAGCGAAT
ATGATAGTTCTTCGTATATATTTTATATATGTATATATAACCTGTTCCGA
AACGATATATCACCAAGCCATCACATCTGCAGCGTATCACGCTTGATATC
CAACTGCCATGCGACACTCTCTGTAATGAAAGCTAAACTTCCACGGAATG
CCAGAAAGCTTTTTGGCTGTGCATTCGAAGGAAATATGATTCAGACATCG
TCAACAGAGCCGGCAAGCGATAAGTCTCATTGTTTTGTCCAGTTTCTCAT
TTCACGCCCTGCCCTAAAGTCGTTTTTCTTTGCGCTCAAGCTATAACCAT
GATGTACTCTAAGGCTGAAGTGTAATGGCCTCTGAATTGGTTAGTTACTT
ACCAACAACTGATCCTGATCTTCTTCTTAATTCACAGAGTCCAGGCAGCG
AACATGTCGCTGGGTGCCATGCATTGTACGCGATGTGCCGACGGCTTCGA
GCCGACTGAGAAGATTGTTAACTCCAATGGAGAACTCTGGCACACCCAGT
GCTTCGTATGTGCCCAGTGCTTCCGACCCTTCCAGGATGGGATATTCTAC
GAGTTCGAGGGCCGTAAGTACTGTGAACGCGACTTTCACGTGCTCTTCGC
TCCCTGCTGCAACAAGTGCGGCGAGTTCGTCATCGGACGGGTCATCAAGG
CCATGTCAGCTAGCTGGCATCCACAGTGCTTCCGCTGCCAATTGTGCGCC
AAGGAGCTGGCTGATTGCGGATTCATCAAGAACCAGAACCGCGCCTTGTG
TCACGAGTGCAATGCCAAGGTGAAGGCGGAGATTACCGGCCGCTATGTAT
GCCAAAAATGCCACGGCCTCATCGACGAGGAGCCTTTGCGATTCCGGGGC
GAAGTGTACCACGGCTATCACTTCAGTTGCACGGCCTGCGGCACAGAGTT
GGATTCCACTGCTCGGGAGGTCAAGAGCCGGCCAGGATTGGCTGCTAACG
ATATGAACGAACTGTATTGTCTGCGTTGTCACGATAAAATGGGCATTCCC
ATATGTGGTGCCTGTCGTCGTCCGATTGAGGAGAGGGTGGTAACGGCGCT
CGGAAAGCACTGGCATGTGGAACATTTCGTGTGCGCCAAGTGCGAGAAAC
CCTTCTTGGGTCACCGACACTACGAGAAGCGGGGATTGGCCTACTGCGAG
ACGCACTATCATCAGCTCTTTGGCAACCTGTGCTTCGTCTGCAACCAGGT
TATTGGAGGCGATGTTTTCACTGCCTTGAACAAGGCCTGGTGTGTGCACC
ACTTTGCGTGCTCCGTGTGCGACACGAAGATGACACAAAAATCGAAATTC
TACGAGTACGACGAGAAGCCGGTGTGCAAAAAGTGCTATGACCGATTTCC
AAACGAACTCAGACGACGTCTGCGCACCGCCCACGAGATGACAATGAAAA
AGAACACCTAATGCCTTGGAGCGAGTCTCAGATCCACACCAAACAGTGCC
TTTGTCGTTGTAGACCCGCTTTCACTACCATTTTTAACATTTGAGAAACT
AAAACCAAACAAACTAAAACCTCTTGTGCATGTCCTTTCCGTCTGTTGTA
ATCCGGTTGTGTGTAACTTAAATTTTAAATCGAGAATCAACGGCATCAAT
AGCTAGGGAACATAACATTGTGTATTAAAAGCCTTTAACGTTGTTAAAAA
AAAAAAAAAAAAA

LD39308.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:29:33
Subject Length Description Subject Range Query Range Score Percent Strand
stck-RB 1844 stck-RB 463..1721 1438..2696 6295 100 Plus
stck.d 1743 stck.d 362..1620 1438..2696 6295 100 Plus
stck.g 1579 stck.g 259..1517 1438..2696 6295 100 Plus
stck-RB 1844 stck-RB 40..462 1..423 2115 100 Plus
stck.d 1743 stck.d 1..361 63..423 1805 100 Plus
stck.g 1579 stck.g 1..258 1114..1371 1290 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:47:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4183049..4184605 1..1557 7770 99.9 Plus
chr3R 27901430 chr3R 4185545..4185976 2264..2695 2160 100 Plus
chr3R 27901430 chr3R 4184664..4184969 1558..1863 1530 100 Plus
chr3R 27901430 chr3R 4185222..4185481 2005..2264 1300 100 Plus
chr3R 27901430 chr3R 4185024..4185165 1864..2005 710 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:46:57
Subject Length Description Subject Range Query Range Score Percent Strand
stck-RC 1047 CG7954-PC 24..1047 1438..2461 5120 100 Plus
stck-RB 1038 CG7954-PB 15..1038 1438..2461 5120 100 Plus
stck-RD 1008 CG7954-PD 1..1008 1454..2461 5040 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:34:01 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:46:56
Subject Length Description Subject Range Query Range Score Percent Strand
stck-RA 1380 CG7954-RA 117..1376 1436..2695 6300 100 Plus
stck-RD 1500 CG7954-RD 239..1496 1438..2695 6290 100 Plus
stck-RC 1335 CG7954-RC 78..1335 1438..2695 6290 100 Plus
stck-RD 1500 CG7954-RD 117..238 302..423 610 100 Plus
stck-RA 1380 CG7954-RA 57..118 1..62 310 100 Plus
stck-RD 1500 CG7954-RD 57..118 1..62 310 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:47:01
Subject Length Description Subject Range Query Range Score Percent Strand
stck-PC 348 CG7954-PC 1..348 1349..2458 1949 94.1 Plus
stck-PB 345 CG7954-PB 5..345 1436..2458 1944 99.7 Plus
stck-PD 335 CG7954-PD 1..335 1454..2458 1920 100 Plus
stck-PA 335 CG7954-PA 1..335 1454..2458 1920 100 Plus
Pax-PB 556 CG31794-PB 322..553 1655..2395 400 32.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:46:53
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8357034..8358590 1..1557 7785 100 Plus
3R 32079331 3R 8359529..8359961 2264..2696 2165 100 Plus
3R 32079331 3R 8358649..8358954 1558..1863 1530 100 Plus
3R 32079331 3R 8359206..8359465 2005..2264 1300 100 Plus
3R 32079331 3R 8359009..8359150 1864..2005 710 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:51:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8097865..8099421 1..1557 7785 100 Plus
3R 31820162 3R 8100360..8100792 2264..2696 2165 100 Plus
3R 31820162 3R 8099480..8099785 1558..1863 1530 100 Plus
3R 31820162 3R 8100037..8100296 2005..2264 1300 100 Plus
3R 31820162 3R 8099840..8099981 1864..2005 710 100 Plus
Blast to na_te.dros performed on 2014-11-26 19:46:54 has no hits.

LD39308.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:27:47 Download gff for LD39308.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4185546..4185976 2265..2695 100   Plus
chr3R 4185223..4185481 2006..2264 100 -> Plus
chr3R 4185024..4185165 1864..2005 100 -> Plus
chr3R 4184664..4184969 1558..1863 100 -> Plus
chr3R 4183049..4184605 1..1557 97 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:21:33 Download gff for LD39308.complete
Subject Subject Range Query Range Percent Splice Strand
stck-RC 24..1047 1438..2461 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:17:19 Download gff for LD39308.complete
Subject Subject Range Query Range Percent Splice Strand
stck-RC 24..1047 1438..2461 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:53:44 Download gff for LD39308.complete
Subject Subject Range Query Range Percent Splice Strand
stck-RB 15..1038 1438..2461 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:48:48 Download gff for LD39308.complete
Subject Subject Range Query Range Percent Splice Strand
stck-RB 15..1038 1438..2461 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:27:47 Download gff for LD39308.complete
Subject Subject Range Query Range Percent Splice Strand
stck-RB 15..1038 1438..2461 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed on 2008-11-11 00:11:59 has no hits.
Sim4 to dmel-all-transcript-r5.32.fasta performed on 2011-03-16 20:17:19 has no hits.
Sim4 to dmel-all-transcript-r5.52.fasta performed on 2013-08-04 01:53:44 has no hits.
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-04 17:33:18 Download gff for LD39308.complete
Subject Subject Range Query Range Percent Splice Strand
stck-RA 68..127 1..60 100 == Plus
stck-RA 128..1387 1436..2695 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed on 2014-11-26 21:27:47 has no hits.
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:27:47 Download gff for LD39308.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8359530..8359960 2265..2695 100   Plus
3R 8359207..8359465 2006..2264 100 -> Plus
3R 8359009..8359150 1864..2005 100 -> Plus
3R 8358649..8358954 1558..1863 100 -> Plus
3R 8357034..8358590 1..1557 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:53:44 Download gff for LD39308.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4185252..4185682 2265..2695 100   Plus
arm_3R 4184929..4185187 2006..2264 100 -> Plus
arm_3R 4184731..4184872 1864..2005 100 -> Plus
arm_3R 4184371..4184676 1558..1863 100 -> Plus
arm_3R 4182756..4184312 1..1557 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:26:56 Download gff for LD39308.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8100361..8100791 2265..2695 100   Plus
3R 8100038..8100296 2006..2264 100 -> Plus
3R 8099840..8099981 1864..2005 100 -> Plus
3R 8099480..8099785 1558..1863 100 -> Plus
3R 8097865..8099421 1..1557 100 -> Plus

LD39308.pep Sequence

Translation from 1453 to 2460

> LD39308.pep
MSLGAMHCTRCADGFEPTEKIVNSNGELWHTQCFVCAQCFRPFQDGIFYE
FEGRKYCERDFHVLFAPCCNKCGEFVIGRVIKAMSASWHPQCFRCQLCAK
ELADCGFIKNQNRALCHECNAKVKAEITGRYVCQKCHGLIDEEPLRFRGE
VYHGYHFSCTACGTELDSTAREVKSRPGLAANDMNELYCLRCHDKMGIPI
CGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHRHYEKRGLAYCET
HYHQLFGNLCFVCNQVIGGDVFTALNKAWCVHHFACSVCDTKMTQKSKFY
EYDEKPVCKKCYDRFPNELRRRLRTAHEMTMKKNT*

LD39308.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 04:17:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16102-PA 348 GF16102-PA 14..348 1..335 1789 99.1 Plus
Dana\GF15196-PA 620 GF15196-PA 363..618 68..315 315 30.1 Plus
Dana\GF22290-PA 178 GF22290-PA 6..176 132..311 249 32 Plus
Dana\GF15196-PA 620 GF15196-PA 364..537 133..316 233 33.7 Plus
Dana\GF15196-PA 620 GF15196-PA 374..620 20..257 228 26.9 Plus
Dana\GF15150-PA 178 GF15150-PA 1..176 127..311 226 29 Plus
Dana\GF19820-PA 152 GF19820-PA 5..150 132..289 199 29.7 Plus
Dana\GF22290-PA 178 GF22290-PA 75..178 19..121 192 36.5 Plus
Dana\GF15150-PA 178 GF15150-PA 75..177 19..120 188 35 Plus
Dana\GF22290-PA 178 GF22290-PA 6..121 200..315 160 30.2 Plus
Dana\GF22290-PA 178 GF22290-PA 16..172 19..179 160 25.9 Plus
Dana\GF15150-PA 178 GF15150-PA 7..161 8..168 146 27.2 Plus
Dana\GF15150-PA 178 GF15150-PA 6..119 200..313 142 30.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 04:17:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10588-PA 348 GG10588-PA 14..348 1..335 1798 99.7 Plus
Dere\GG21635-PA 584 GG21635-PA 350..582 68..315 346 32.5 Plus
Dere\GG18228-PA 200 GG18228-PA 28..198 132..311 248 31.5 Plus
Dere\GG21635-PA 584 GG21635-PA 361..584 20..257 237 28 Plus
Dere\GG21514-PA 178 GG21514-PA 1..176 127..311 231 30.1 Plus
Dere\GG22918-PA 175 GG22918-PA 5..174 132..311 230 29.4 Plus
Dere\GG21635-PA 584 GG21635-PA 419..582 19..196 206 29.1 Plus
Dere\GG21514-PA 178 GG21514-PA 75..177 19..120 189 35 Plus
Dere\GG18228-PA 200 GG18228-PA 97..200 19..121 185 35.6 Plus
Dere\GG18228-PA 200 GG18228-PA 7..143 179..315 169 27.7 Plus
Dere\GG18228-PA 200 GG18228-PA 38..194 19..179 155 26.5 Plus
Dere\GG21514-PA 178 GG21514-PA 6..121 200..315 144 29.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 04:17:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14398-PA 348 GH14398-PA 14..348 1..335 1763 97 Plus
Dgri\GH13469-PA 585 GH13469-PA 351..583 68..315 346 33.3 Plus
Dgri\GH12803-PA 179 GH12803-PA 7..177 132..311 262 33.7 Plus
Dgri\GH13469-PA 585 GH13469-PA 362..585 20..257 232 27.6 Plus
Dgri\GH10298-PA 189 GH10298-PA 16..187 131..311 220 29.1 Plus
Dgri\GH20594-PA 1166 GH20594-PA 990..1164 67..251 208 29.6 Plus
Dgri\GH13469-PA 585 GH13469-PA 420..583 19..196 205 29.1 Plus
Dgri\GH12803-PA 179 GH12803-PA 76..179 19..121 181 32.7 Plus
Dgri\GH10298-PA 189 GH10298-PA 26..172 18..168 181 29.6 Plus
Dgri\GH10298-PA 189 GH10298-PA 75..188 9..120 179 33.3 Plus
Dgri\GH12803-PA 179 GH12803-PA 1..175 1..181 162 26.9 Plus
Dgri\GH10298-PA 189 GH10298-PA 18..130 201..313 148 33.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 04:17:09
Subject Length Description Subject Range Query Range Score Percent Strand
stck-PD 335 CG7954-PD 1..335 1..335 1920 100 Plus
stck-PA 335 CG7954-PA 1..335 1..335 1920 100 Plus
stck-PB 345 CG7954-PB 11..345 1..335 1920 100 Plus
stck-PC 348 CG7954-PC 14..348 1..335 1920 100 Plus
Pax-PB 556 CG31794-PB 322..553 68..314 400 32.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 04:17:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10041-PA 348 GI10041-PA 14..348 1..335 1753 96.4 Plus
Dmoj\GI17221-PA 605 GI17221-PA 371..603 68..315 346 32.5 Plus
Dmoj\GI15958-PA 179 GI15958-PA 7..179 132..313 252 32.2 Plus
Dmoj\GI17221-PA 605 GI17221-PA 382..605 20..257 233 27.6 Plus
Dmoj\GI17994-PA 183 GI17994-PA 11..181 132..311 233 29.8 Plus
Dmoj\GI19738-PA 1709 GI19738-PA 1533..1707 67..251 207 29.6 Plus
Dmoj\GI17221-PA 605 GI17221-PA 440..603 19..196 206 29.1 Plus
Dmoj\GI15958-PA 179 GI15958-PA 76..178 19..120 196 37.9 Plus
Dmoj\GI17994-PA 183 GI17994-PA 80..182 19..120 189 35.9 Plus
Dmoj\GI15958-PA 179 GI15958-PA 1..173 1..179 155 25.6 Plus
Dmoj\GI17994-PA 183 GI17994-PA 11..124 200..313 155 34.2 Plus
Dmoj\GI17994-PA 183 GI17994-PA 20..166 18..168 146 26.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 04:17:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24193-PA 348 GL24193-PA 14..348 1..335 1778 98.5 Plus
Dper\GL21108-PA 639 GL21108-PA 387..637 68..315 320 31.5 Plus
Dper\GL25856-PA 177 GL25856-PA 1..176 127..311 238 30.9 Plus
Dper\GL21108-PA 639 GL21108-PA 398..639 20..257 231 27.4 Plus
Dper\GL11647-PA 185 GL11647-PA 5..174 132..311 204 30 Plus
Dper\GL20860-PA 340 GL20860-PA 96..319 5..236 195 26.9 Plus
Dper\GL21108-PA 639 GL21108-PA 456..637 19..196 194 28.4 Plus
Dper\GL25856-PA 177 GL25856-PA 75..177 19..120 182 34 Plus
Dper\GL11647-PA 185 GL11647-PA 61..185 7..129 171 31.2 Plus
Dper\GL25856-PA 177 GL25856-PA 15..161 18..168 149 26.3 Plus
Dper\GL25856-PA 177 GL25856-PA 6..121 200..315 146 30.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 04:17:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20717-PA 348 GA20717-PA 14..348 1..335 1785 99.1 Plus
Dpse\GA20717-PC 345 GA20717-PC 11..345 1..335 1784 99.1 Plus
Dpse\GA20717-PB 335 GA20717-PB 1..335 1..335 1781 99.1 Plus
Dpse\GA16481-PA 632 GA16481-PA 380..630 68..315 319 31.5 Plus
Dpse\GA16596-PA 177 GA16596-PA 1..176 127..311 238 30.9 Plus
Dpse\GA16481-PA 632 GA16481-PA 391..632 20..257 231 27.4 Plus
Dpse\GA16481-PA 632 GA16481-PA 449..630 19..196 194 28.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 04:17:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23732-PA 348 GM23732-PA 14..348 1..335 1799 99.7 Plus
Dsec\GM17013-PA 581 GM17013-PA 347..579 68..315 346 32.5 Plus
Dsec\GM17013-PA 581 GM17013-PA 358..581 20..257 237 28 Plus
Dsec\GM13370-PA 209 GM13370-PA 37..209 132..313 234 31.1 Plus
Dsec\GM22049-PA 178 GM22049-PA 1..176 127..311 227 29.6 Plus
Dsec\GM23266-PA 178 GM23266-PA 1..176 127..311 227 29.6 Plus
Dsec\GM17013-PA 581 GM17013-PA 416..579 19..196 206 29.1 Plus
Dsec\GM13370-PA 209 GM13370-PA 106..208 19..120 198 36.9 Plus
Dsec\GM22049-PA 178 GM22049-PA 75..177 19..120 194 35.9 Plus
Dsec\GM13370-PA 209 GM13370-PA 48..203 20..179 169 28 Plus
Dsec\GM22049-PA 178 GM22049-PA 6..121 200..315 158 31 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 04:17:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18542-PA 348 GD18542-PA 14..348 1..335 1801 100 Plus
Dsim\GD21763-PA 678 GD21763-PA 416..676 19..315 315 28 Plus
Dsim\GD21763-PA 678 GD21763-PA 348..458 201..312 238 42 Plus
Dsim\GD21763-PA 678 GD21763-PA 348..530 133..324 236 33.2 Plus
Dsim\GD15732-PA 209 GD15732-PA 37..209 132..313 231 31.1 Plus
Dsim\GD17716-PA 178 GD17716-PA 1..176 127..311 227 29.6 Plus
Dsim\GD21644-PA 178 GD21644-PA 1..176 127..311 227 29.6 Plus
Dsim\GD21763-PA 678 GD21763-PA 347..513 68..248 201 28.6 Plus
Dsim\GD15732-PA 209 GD15732-PA 106..208 19..120 198 36.9 Plus
Dsim\GD17716-PA 178 GD17716-PA 75..177 19..120 194 35.9 Plus
Dsim\GD15732-PA 209 GD15732-PA 48..203 20..179 170 28 Plus
Dsim\GD17716-PA 178 GD17716-PA 6..121 200..315 158 31 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 04:17:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22568-PA 348 GJ22568-PA 14..348 1..335 1765 97.3 Plus
Dvir\GJ17978-PA 597 GJ17978-PA 363..595 68..315 347 32.5 Plus
Dvir\GJ19592-PA 181 GJ19592-PA 2..179 125..311 243 30.3 Plus
Dvir\GJ17978-PA 597 GJ17978-PA 374..597 20..257 234 27.6 Plus
Dvir\GJ18448-PA 1587 GJ18448-PA 1411..1585 67..251 209 29.6 Plus
Dvir\GJ17978-PA 597 GJ17978-PA 432..595 19..196 207 29.1 Plus
Dvir\GJ18448-PA 1587 GJ18448-PA 1412..1583 132..309 201 30 Plus
Dvir\GJ19592-PA 181 GJ19592-PA 78..180 19..120 191 35.9 Plus
Dvir\GJ12349-PA 335 GJ12349-PA 91..314 5..236 189 26.5 Plus
Dvir\GJ18448-PA 1587 GJ18448-PA 1425..1572 22..170 182 31.2 Plus
Dvir\GJ19592-PA 181 GJ19592-PA 9..122 200..313 157 33.3 Plus
Dvir\GJ19592-PA 181 GJ19592-PA 18..164 18..168 151 26.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 04:17:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13878-PA 348 GK13878-PA 14..348 1..335 1782 98.5 Plus
Dwil\GK22266-PA 169 GK22266-PA 20..169 161..310 722 88 Plus
Dwil\GK16085-PA 290 GK16085-PA 169..254 185..270 430 87.2 Plus
Dwil\GK23838-PA 630 GK23838-PA 373..628 68..315 313 30.9 Plus
Dwil\GK15192-PA 177 GK15192-PA 1..176 127..311 243 28.5 Plus
Dwil\GK23838-PA 630 GK23838-PA 374..547 133..316 230 33.7 Plus
Dwil\GK23838-PA 630 GK23838-PA 384..630 20..257 225 26.9 Plus
Dwil\GK22266-PA 169 GK22266-PA 69..154 19..104 149 34.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 04:17:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25876-PA 348 GE25876-PA 14..347 1..334 1791 99.7 Plus
Dyak\GE12653-PA 581 GE12653-PA 347..579 68..315 346 32.5 Plus
Dyak\GE15647-PA 179 GE15647-PA 7..177 132..311 256 32.6 Plus
Dyak\GE12653-PA 581 GE12653-PA 358..581 20..257 237 28 Plus
Dyak\GE12993-PA 178 GE12993-PA 1..176 127..311 232 30.1 Plus
Dyak\GE14355-PA 187 GE14355-PA 5..184 132..319 223 28.9 Plus
Dyak\GE12653-PA 581 GE12653-PA 416..579 19..196 206 29.1 Plus
Dyak\GE12993-PA 178 GE12993-PA 75..177 19..120 189 35 Plus
Dyak\GE15647-PA 179 GE15647-PA 76..179 19..121 186 35.6 Plus
Dyak\GE15647-PA 179 GE15647-PA 5..122 198..315 166 30.5 Plus
Dyak\GE15647-PA 179 GE15647-PA 1..173 1..179 152 25.6 Plus
Dyak\GE12993-PA 178 GE12993-PA 6..121 200..315 144 29.3 Plus

LD39308.hyp Sequence

Translation from 1453 to 2460

> LD39308.hyp
MSLGAMHCTRCADGFEPTEKIVNSNGELWHTQCFVCAQCFRPFQDGIFYE
FEGRKYCERDFHVLFAPCCNKCGEFVIGRVIKAMSASWHPQCFRCQLCAK
ELADCGFIKNQNRALCHECNAKVKAEITGRYVCQKCHGLIDEEPLRFRGE
VYHGYHFSCTACGTELDSTAREVKSRPGLAANDMNELYCLRCHDKMGIPI
CGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHRHYEKRGLAYCET
HYHQLFGNLCFVCNQVIGGDVFTALNKAWCVHHFACSVCDTKMTQKSKFY
EYDEKPVCKKCYDRFPNELRRRLRTAHEMTMKKNT*

LD39308.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:05:15
Subject Length Description Subject Range Query Range Score Percent Strand
stck-PD 335 CG7954-PD 1..335 1..335 1920 100 Plus
stck-PA 335 CG7954-PA 1..335 1..335 1920 100 Plus
stck-PB 345 CG7954-PB 11..345 1..335 1920 100 Plus
stck-PC 348 CG7954-PC 14..348 1..335 1920 100 Plus
Pax-PB 556 CG31794-PB 322..553 68..314 400 32.7 Plus