Clone LD43104 Report

Search the DGRC for LD43104

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:431
Well:4
Vector:pOT2
Associated Gene/TranscriptSam-S-RG
Protein status:LD43104.pep: gold
Sequenced Size:1974

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
M(2)21AB-RG 2009-06-22 Replacement based on scoring

Clone Sequence Records

LD43104.complete Sequence

1974 bp assembled on 2009-09-23

GenBank Submission: BT099838.1

> LD43104.complete
TTTGACAACAGCTGTTGATAAGCCGAGCGACCTTTTATACTACGCATTGA
TTACTTTTACTATTCTATACTATTTTATTTTATAATGCTAATTAAGTCGG
CTTGGCAAGCTAGCCCTAGACAATCTAGCCCTATACAATCGTGATGATAA
GCGCCGAGTGCCATTCAGAAGAATACACCCCAAATGACAAAATGTGCGAC
CAAATCAGCGACGCTATCTTGGATGCCCATCTGAAGCAGGATCCAAACGC
GAAGGTGGCGTGTGAAACCGTCGCCAAGACGGGCATGATTCTGCTGTGCG
GCGAGATCACGTCTAAGGCTGTGGTCGACTACCAGAAGGTTGTTCGTGAG
ACAGTGCAGCACATTGGTTATGATGACTCCTCCAAGGGTTTCGATTGGAA
GACACTTAACCTGCTTGTAGCCATCGAGCAACAGTCGCCCAACATTGCCA
ACGGCGTTCATATCAACCGCGAAGAAGAAGACGTCGGCGCTGGTGACCAG
GGTATCATGTTTGGATATGCCACCGACGAAACCGAGGAATGTATGCCCCT
AACCGTCGTTTTGGCTCACAAACTAAACGAAAAGATTGCTGAGCTGCGTC
GCTCAGATGTGTTCTGGTGGGCTCGCCCCGATTCCAAAACACAAGTAACC
TGCGAGTACCTCTTCAATCAGGGATCAGCAGTTCCCAAGCGTGTCCACAC
TATTGTAGTGTCCATGCAGCATTCTGAAAAGATATCGTTAGAAACCCTGC
GCTCGGAAGTAATGGAGAAAGTTGTTAAAGTAGTCATTCCCGCCAAATAC
ATTGATGCCAACACCATTGTCCACATCAATCCTTGTGGGCTTTTTGTAAT
CGGTGGACCAATGGGTGACGCTGGGCTTACAGGAAGAAAAATCATTGTAG
ATACTTACGGAGGCTGGGGCGCCCACGGCGGCGGTGCATTCTCTGGCAAG
GACTTCACCAAGGTTGACAGATCAGCTGCATATGCAGCACGCTGGGTGGC
CAAATCACTGGTTAAGGCCGGTCTCTGCAAGCGCTGCCTTGTCCAAGTGT
CCTACGCCATAGGTCTTGCTGAGCCTCTCTCCATAACTGTGTTCGACTAC
GGAACTTCTCACAAGTCACAAAAAGAACTTCTGGATATCATCCGTCGAAA
CTTTGACCTCAGGCCCGGCAAGATTGTCAAGGACCTAAACCTGCGCCAGC
CGATATACCAGCGAACAAGCACTTATGGACACTTCGGTCGCGCGGGCTTC
TCGTGGGAGGAGGCCAAGCCTCTGGAGATTGACAACTGACTAGACGCTGA
AGCGTTGCAACCGCAGTCACCATATGCTAAAAGGTCGAAGCTATCCTTAT
ATTCATCAGCGTCAAAATTAACAGATACCCAAGCACCAACGTAATTTTTA
GTGTCGTTTTTAAAGCCTAAAGTCAGAGGAGAAGGCGGCATAGGCTTGCC
AACTCTTATGGGCTTTCTTCTCTAACTTATGCTGTGCTCTTCGCTATATA
ATTTAAACCATTCTGATGTGTGTAGTCTTCTCACACGGAACTAGTTTTAG
TCGTCTTAATACCCGCATATATACCTAATAGAGAGCTCCAAAAGAATTGA
TGAGCTTTAGTTATGCATATACATAGTATAGTGTCGGTCAGTTCAGTAAA
AATTAAAGCAGTAGTTAGTACCTCCTTCAATTATCATGCAACTTAATTAT
GTTGGTGTCTATGGAAATTGTATAAAACAATTAAATCCGTTGCCTAGAAA
TTATGCAACATTCTCATGTCCCCATTGTAAACTTATTTTTGTCTCTTTTA
ACATTTCTATTTGTTGTATGCGTTGTATATGTTAAACCTAAAGTTTTAAA
CAACTCGATTGTATGTACATTACACTCTGTCTTTGTATTTTCTGTAACCA
ACCATAAGATAATGTATTTTCCTTTACAAAAATATATTAAAGATAAATAT
GAAAAGTAAAAAAAAAAAAAAAAA

LD43104.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:49:40
Subject Length Description Subject Range Query Range Score Percent Strand
M(2)21AB-RG 2223 M(2)21AB-RG 45..2002 1..1958 9790 100 Plus
M(2)21AB-RC 2637 M(2)21AB-RC 563..2335 186..1958 8865 100 Plus
M(2)21AB-RB 2407 M(2)21AB-RB 687..2186 459..1958 7335 99.2 Plus
M(2)21AB-RB 2407 M(2)21AB-RB 301..616 186..501 1580 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:15:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 113471..114247 1181..1957 3870 99.9 Plus
chr2L 23010047 chr2L 112724..113407 498..1181 3420 100 Plus
chr2L 23010047 chr2L 109645..109830 1..186 930 100 Plus
chr2L 23010047 chr2L 110791..110916 264..389 630 100 Plus
chr2L 23010047 chr2L 111041..111155 387..501 575 100 Plus
chr2L 23010047 chr2L 110442..110520 186..264 395 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:15:44
Subject Length Description Subject Range Query Range Score Percent Strand
Sam-S-RG 1146 CG2674-PG 1..1146 144..1289 5730 100 Plus
Sam-S-RJ 1227 CG2674-PJ 124..1227 186..1289 5520 100 Plus
Sam-S-RC 1227 CG2674-PC 124..1227 186..1289 5520 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:38:22 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:15:42
Subject Length Description Subject Range Query Range Score Percent Strand
Sam-S-RG 1971 CG2674-RG 15..1971 1..1957 9785 100 Plus
Sam-S-RJ 2309 CG2674-RJ 316..2087 186..1957 8860 100 Plus
Sam-S-RC 2380 CG2674-RC 387..2158 186..1957 8860 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:15:46
Subject Length Description Subject Range Query Range Score Percent Strand
Sam-S-PG 381 CG2674-PG 1..381 144..1286 1906 100 Plus
Sam-S-PJ 408 CG2674-PJ 42..408 186..1286 1828 100 Plus
Sam-S-PC 408 CG2674-PC 42..408 186..1286 1828 100 Plus
Sam-S-PE 408 CG2674-PE 42..408 186..1286 1776 96.7 Plus
Sam-S-PA 408 CG2674-PA 42..408 186..1286 1776 96.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:15:39
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 113434..114211 1181..1958 3890 100 Plus
2L 23513712 2L 112687..113370 498..1181 3420 100 Plus
2L 23513712 2L 109608..109793 1..186 930 100 Plus
2L 23513712 2L 110754..110879 264..389 630 100 Plus
2L 23513712 2L 111004..111118 387..501 575 100 Plus
2L 23513712 2L 110405..110483 186..264 395 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:46:35
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 113434..114211 1181..1958 3890 100 Plus
2L 23513712 2L 112687..113370 498..1181 3420 100 Plus
2L 23513712 2L 109608..109793 1..186 930 100 Plus
2L 23513712 2L 110754..110879 264..389 630 100 Plus
2L 23513712 2L 111004..111118 387..501 575 100 Plus
2L 23513712 2L 110405..110483 186..264 395 100 Plus
Blast to na_te.dros performed 2014-11-27 09:15:41
Subject Length Description Subject Range Query Range Score Percent Strand
blood 7410 blood BLOOD 7410bp 6910..6963 46..99 117 68.5 Plus

LD43104.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:40:30 Download gff for LD43104.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 113471..114247 1181..1957 99   Plus
chr2L 112727..113406 501..1180 100 -> Plus
chr2L 111042..111154 388..500 100 -> Plus
chr2L 110792..110914 265..387 100 -> Plus
chr2L 110443..110520 187..264 100 -> Plus
chr2L 109645..109830 1..186 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:55:22 Download gff for LD43104.complete
Subject Subject Range Query Range Percent Splice Strand
M(2)21AB-RG 1..1146 144..1289 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:33:29 Download gff for LD43104.complete
Subject Subject Range Query Range Percent Splice Strand
Sam-S-RG 1..1146 144..1289 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:20:14 Download gff for LD43104.complete
Subject Subject Range Query Range Percent Splice Strand
Sam-S-RG 1..1146 144..1289 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:40:30 Download gff for LD43104.complete
Subject Subject Range Query Range Percent Splice Strand
Sam-S-RG 1..1146 144..1289 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-25 08:14:27 Download gff for LD43104.complete
Subject Subject Range Query Range Percent Splice Strand
M(2)21AB-RG 1..1957 1..1957 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:33:29 Download gff for LD43104.complete
Subject Subject Range Query Range Percent Splice Strand
Sam-S-RG 1..1957 1..1957 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:20:14 Download gff for LD43104.complete
Subject Subject Range Query Range Percent Splice Strand
Sam-S-RG 15..1971 1..1957 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:40:30 Download gff for LD43104.complete
Subject Subject Range Query Range Percent Splice Strand
Sam-S-RG 15..1971 1..1957 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:40:30 Download gff for LD43104.complete
Subject Subject Range Query Range Percent Splice Strand
2L 113434..114210 1181..1957 100   Plus
2L 112690..113369 501..1180 100 -> Plus
2L 111005..111117 388..500 100 -> Plus
2L 110755..110877 265..387 100 -> Plus
2L 110406..110483 187..264 100 -> Plus
2L 109608..109793 1..186 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:20:14 Download gff for LD43104.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 113434..114210 1181..1957 100   Plus
arm_2L 112690..113369 501..1180 100 -> Plus
arm_2L 111005..111117 388..500 100 -> Plus
arm_2L 110755..110877 265..387 100 -> Plus
arm_2L 110406..110483 187..264 100 -> Plus
arm_2L 109608..109793 1..186 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:17:45 Download gff for LD43104.complete
Subject Subject Range Query Range Percent Splice Strand
2L 113434..114210 1181..1957 100   Plus
2L 112690..113369 501..1180 100 -> Plus
2L 111005..111117 388..500 100 -> Plus
2L 110755..110877 265..387 100 -> Plus
2L 110406..110483 187..264 100 -> Plus
2L 109608..109793 1..186 100 -> Plus

LD43104.pep Sequence

Translation from 143 to 1288

> LD43104.pep
MISAECHSEEYTPNDKMCDQISDAILDAHLKQDPNAKVACETVAKTGMIL
LCGEITSKAVVDYQKVVRETVQHIGYDDSSKGFDWKTLNLLVAIEQQSPN
IANGVHINREEEDVGAGDQGIMFGYATDETEECMPLTVVLAHKLNEKIAE
LRRSDVFWWARPDSKTQVTCEYLFNQGSAVPKRVHTIVVSMQHSEKISLE
TLRSEVMEKVVKVVIPAKYIDANTIVHINPCGLFVIGGPMGDAGLTGRKI
IVDTYGGWGAHGGGAFSGKDFTKVDRSAAYAARWVAKSLVKAGLCKRCLV
QVSYAIGLAEPLSITVFDYGTSHKSQKELLDIIRRNFDLRPGKIVKDLNL
RQPIYQRTSTYGHFGRAGFSWEEAKPLEIDN*

LD43104.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 05:27:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14863-PA 445 GF14863-PA 45..445 15..380 1762 89.8 Plus
Dana\GF16137-PA 147 GF16137-PA 1..147 199..380 669 76.4 Plus
Dana\GF16127-PA 383 GF16127-PA 280..383 41..145 464 84.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 05:27:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24695-PA 408 GG24695-PA 42..408 15..381 1959 99.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 05:27:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10060-PA 448 GH10060-PA 48..448 15..380 1784 87.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 05:27:35
Subject Length Description Subject Range Query Range Score Percent Strand
Sam-S-PG 381 CG2674-PG 1..381 1..381 1998 100 Plus
Sam-S-PJ 408 CG2674-PJ 42..408 15..381 1920 100 Plus
Sam-S-PC 408 CG2674-PC 42..408 15..381 1920 100 Plus
Sam-S-PE 408 CG2674-PE 42..408 15..381 1868 96.7 Plus
Sam-S-PA 408 CG2674-PA 42..408 15..381 1868 96.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 05:27:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16450-PA 421 GI16450-PA 47..421 15..380 1620 81 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 05:27:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16618-PA 407 GL16618-PA 42..407 15..380 1748 94.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 05:27:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15421-PA 407 GA15421-PA 42..407 15..380 1793 97.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 05:27:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16715-PA 408 GM16715-PA 42..408 15..381 1963 99.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 05:27:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23001-PA 381 GD23001-PA 1..381 1..381 2045 99.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 05:27:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16217-PA 412 GJ16217-PA 47..412 15..380 1731 93.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 05:27:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24606-PA 447 GK24606-PA 47..447 15..380 1751 88.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 05:27:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16582-PA 464 GE16582-PA 42..464 15..381 1684 82.3 Plus

LD43104.hyp Sequence

Translation from 143 to 1288

> LD43104.hyp
MISAECHSEEYTPNDKMCDQISDAILDAHLKQDPNAKVACETVAKTGMIL
LCGEITSKAVVDYQKVVRETVQHIGYDDSSKGFDWKTLNLLVAIEQQSPN
IANGVHINREEEDVGAGDQGIMFGYATDETEECMPLTVVLAHKLNEKIAE
LRRSDVFWWARPDSKTQVTCEYLFNQGSAVPKRVHTIVVSMQHSEKISLE
TLRSEVMEKVVKVVIPAKYIDANTIVHINPCGLFVIGGPMGDAGLTGRKI
IVDTYGGWGAHGGGAFSGKDFTKVDRSAAYAARWVAKSLVKAGLCKRCLV
QVSYAIGLAEPLSITVFDYGTSHKSQKELLDIIRRNFDLRPGKIVKDLNL
RQPIYQRTSTYGHFGRAGFSWEEAKPLEIDN*

LD43104.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:06:50
Subject Length Description Subject Range Query Range Score Percent Strand
Sam-S-PG 381 CG2674-PG 1..381 1..381 1998 100 Plus
Sam-S-PJ 408 CG2674-PJ 42..408 15..381 1920 100 Plus
Sam-S-PC 408 CG2674-PC 42..408 15..381 1920 100 Plus
Sam-S-PE 408 CG2674-PE 42..408 15..381 1868 96.7 Plus
Sam-S-PA 408 CG2674-PA 42..408 15..381 1868 96.7 Plus