Clone LD44083 Report

Search the DGRC for LD44083

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:440
Well:83
Vector:pOT2
Associated Gene/TranscriptTbp-RA
Protein status:LD44083.pep: gold
Preliminary Size:1545
Sequenced Size:1365

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9874 2001-01-01 Release 2 assignment
CG9874 2001-11-02 Blastp of sequenced clone
CG9874 2003-01-01 Sim4 clustering to Release 3
Tbp 2008-04-29 Release 5.5 accounting
Tbp 2008-08-15 Release 5.9 accounting
Tbp 2008-12-18 5.12 accounting

Clone Sequence Records

LD44083.complete Sequence

1365 bp (1365 high quality bases) assembled on 2001-11-02

GenBank Submission: AY069663

> LD44083.complete
CGAACGCGGTTGCATTACATTATTATTATTATTACTATTAAATTAATTTC
CCGCTCTGTGGGTATGCAATTAAAACCCAAAGTTGAGCCCGTTCAGCAAT
CTTGAATTGAGTCACTGAAAAATTCACCGGAGTCCACAATAAACCATCTG
TAAGATGGACCAAATGCTAAGCCCCAACTTCTCGATTCCGAGCATCGGAA
CGCCGCTCCACCAGATGGAAGCGGACCAGCAGATAGTGGCCAATCCTGTG
TACCATCCTCCGGCTGTATCGCAGCCGGATTCGTTGATGCCGGCACCCGG
TTCCAGTTCCGTGCAGCACCAGCAGCAGCAACAGCAGTCGGACGCCAGTG
GGGGATCAGGTCTCTTTGGCCACGAACCATCGCTCCCGCTGGCGCACAAA
CAAATGCAGAGTTACCAGCCATCGGCCTCCTATCAGCAGCAGCAGCAGCA
ACAGCAGCTCCAGAGTCAGGCGCCCGGCGGCGGTGGGAGCACTCCGCAGT
CCATGATGCAGCCGCAGACGCCGCAGAGCATGATGGCCCACATGATGCCC
ATGAGTGAGCGGAGTGTGGGCGGTTCGGGGGCCGGAGGTGGCGGAGATGC
CCTGAGCAACATCCACCAGACGATGGGCCCCTCCACGCCGATGACACCAG
CCACACCAGGTTCCGCTGATCCCGGTATTGTGCCACAACTTCAGAACATC
GTGTCCACGGTTAATCTGTGCTGCAAACTGGACCTCAAGAAAATAGCATT
GCATGCGAGAAACGCCGAGTACAATCCTAAGCGATTTGCGGCTGTGATTA
TGCGAATCCGAGAGCCCCGGACCACCGCCCTTATTTTCAGCTCCGGCAAG
ATGGTGTGCACAGGGGCAAAGAGTGAGGACGACTCCAGACTGGCAGCGAG
AAAGTATGCGCGCATCATCCAAAAGCTCGGTTTCCCTGCAAAGTTCCTCG
ACTTTAAGATTCAAAACATGGTCGGCTCCTGCGATGTCAAGTTCCCCATA
CGCTTGGAAGGCCTGGTGCTGACCCATTGCAACTTCAGCAGCTACGAGCC
TGAGCTATTTCCCGGCTTAATCTATCGTATGGTGCGACCTCGAATCGTGC
TCCTCATCTTCGTGTCCGGAAAGGTGGTGCTCACTGGAGCAAAGGTGCGG
CAGGAGATCTACGATGCCTTCGACAAGATATTCCCCATTTTAAAGAAGTT
CAAGAAGCAGTCATAAATAGGATAGCGCTTTATTAGTTCTGTACGTGTAC
GTTTTAAGGTCGGTAGTTCTGGAAGTCTGATCATATGAGTGGGAGCAGCC
TGGCGAGCAGCTCCGATCGAGAATAAACCACAAAGTAATTTAGCTGTAAA
AAAAAAAAAAAAAAA

LD44083.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:01:37
Subject Length Description Subject Range Query Range Score Percent Strand
Tbp-RA 1385 Tbp-RA 35..1382 1..1348 6740 100 Plus
CG10306-RA 1084 CG10306-RA 961..1084 1348..1225 620 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 04:19:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17573156..17574093 938..1 4660 99.8 Minus
chr2R 21145070 chr2R 17572683..17573092 1347..938 2020 99.5 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:19:13
Subject Length Description Subject Range Query Range Score Percent Strand
Tbp-RA 1062 CG9874-PA 1..1062 155..1216 5310 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:39:36 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:19:11
Subject Length Description Subject Range Query Range Score Percent Strand
Tbp-RA 1387 CG9874-RA 37..1383 1..1347 6735 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 04:19:15
Subject Length Description Subject Range Query Range Score Percent Strand
Tbp-PA 353 CG9874-PA 1..353 155..1213 1377 100 Plus
Trf-PA 224 CG7562-PA 22..223 596..1207 586 55.9 Plus
Trf2-PJ 632 CG18009-PJ 204..377 689..1210 350 41.5 Plus
Trf2-PH 632 CG18009-PH 204..377 689..1210 350 41.5 Plus
Trf2-PI 1714 CG18009-PI 1286..1459 689..1210 350 41.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 04:19:08
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21686669..21687606 938..1 4690 100 Minus
2R 25286936 2R 21686195..21686605 1348..938 2055 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:26:20
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21687868..21688805 938..1 4690 100 Minus
2R 25260384 2R 21687394..21687804 1348..938 2055 100 Minus
Blast to na_te.dros performed 2014-11-27 04:19:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6727..6870 313..462 133 57.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6776..6932 314..467 129 59 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2348..2483 313..463 127 58.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6748..6898 313..463 126 58.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2494..2536 432..474 116 74.4 Plus
roo 9092 roo DM_ROO 9092bp 1084..1113 313..342 114 86.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6802..6825 313..336 111 95.8 Plus

LD44083.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:40:59 Download gff for LD44083.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17573157..17574093 1..937 93   Minus
chr2R 17572683..17573092 938..1347 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:26:52 Download gff for LD44083.complete
Subject Subject Range Query Range Percent Splice Strand
Tbp-RA 1..1062 155..1216 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:35:18 Download gff for LD44083.complete
Subject Subject Range Query Range Percent Splice Strand
Tbp-RA 1..1062 155..1216 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:31:13 Download gff for LD44083.complete
Subject Subject Range Query Range Percent Splice Strand
Tbp-RA 1..1062 155..1216 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:03:29 Download gff for LD44083.complete
Subject Subject Range Query Range Percent Splice Strand
Tbp-RA 1..1062 155..1216 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:40:59 Download gff for LD44083.complete
Subject Subject Range Query Range Percent Splice Strand
Tbp-RA 1..1062 155..1216 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:15:12 Download gff for LD44083.complete
Subject Subject Range Query Range Percent Splice Strand
Tbp-RA 35..1377 1..1343 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:35:18 Download gff for LD44083.complete
Subject Subject Range Query Range Percent Splice Strand
Tbp-RA 35..1377 1..1343 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:31:13 Download gff for LD44083.complete
Subject Subject Range Query Range Percent Splice Strand
Tbp-RA 37..1383 1..1347 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:03:29 Download gff for LD44083.complete
Subject Subject Range Query Range Percent Splice Strand
Tbp-RA 35..1377 1..1343 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:40:59 Download gff for LD44083.complete
Subject Subject Range Query Range Percent Splice Strand
Tbp-RA 37..1383 1..1347 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:40:59 Download gff for LD44083.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21686670..21687606 1..937 100   Minus
2R 21686196..21686605 938..1347 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:31:13 Download gff for LD44083.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17574175..17575111 1..937 100   Minus
arm_2R 17573701..17574110 938..1347 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:39:58 Download gff for LD44083.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21687869..21688805 1..937 100   Minus
2R 21687395..21687804 938..1347 100 <- Minus

LD44083.pep Sequence

Translation from 154 to 1215

> LD44083.pep
MDQMLSPNFSIPSIGTPLHQMEADQQIVANPVYHPPAVSQPDSLMPAPGS
SSVQHQQQQQQSDASGGSGLFGHEPSLPLAHKQMQSYQPSASYQQQQQQQ
QLQSQAPGGGGSTPQSMMQPQTPQSMMAHMMPMSERSVGGSGAGGGGDAL
SNIHQTMGPSTPMTPATPGSADPGIVPQLQNIVSTVNLCCKLDLKKIALH
ARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEDDSRLAARK
YARIIQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHCNFSSYEPE
LFPGLIYRMVRPRIVLLIFVSGKVVLTGAKVRQEIYDAFDKIFPILKKFK
KQS*

LD44083.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 05:39:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11627-PA 348 GF11627-PA 1..348 1..353 1551 87.6 Plus
Dana\GF14757-PA 224 GF14757-PA 26..223 152..351 609 57 Plus
Dana\GF21727-PA 1683 GF21727-PA 1245..1416 179..352 390 41.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 05:39:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20753-PA 349 GG20753-PA 1..349 1..353 1668 97.7 Plus
Dere\GG10512-PA 224 GG10512-PA 15..223 141..351 615 54 Plus
Dere\GG18249-PA 641 GG18249-PA 208..392 169..352 379 40.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 05:39:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23121-PA 348 GH23121-PA 1..348 1..353 1409 82.3 Plus
Dgri\GH11614-PA 220 GH11614-PA 22..219 152..351 607 56.5 Plus
Dgri\GH11849-PA 689 GH11849-PA 197..385 162..352 399 38.7 Plus
Dgri\GH10255-PA 314 GH10255-PA 1..195 153..350 383 37.2 Plus
Dgri\GH23390-PA 259 GH23390-PA 52..219 182..350 153 27.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 05:39:12
Subject Length Description Subject Range Query Range Score Percent Strand
Tbp-PA 353 CG9874-PA 1..353 1..353 1828 100 Plus
Trf-PA 224 CG7562-PA 22..223 148..351 586 55.9 Plus
Trf2-PJ 632 CG18009-PJ 204..377 179..352 350 41.5 Plus
Trf2-PH 632 CG18009-PH 204..377 179..352 350 41.5 Plus
Trf2-PI 1714 CG18009-PI 1286..1459 179..352 350 41.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 05:39:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18943-PA 348 GI18943-PA 1..348 1..353 1379 81.4 Plus
Dmoj\GI17918-PA 220 GI17918-PA 21..219 151..351 613 56.2 Plus
Dmoj\GI14331-PA 656 GI14331-PA 252..436 170..352 410 40.1 Plus
Dmoj\GI15474-PA 442 GI15474-PA 93..264 179..352 393 40.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 05:39:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11271-PA 345 GL11271-PA 1..345 1..353 1539 87.3 Plus
Dper\GL24756-PA 220 GL24756-PA 22..219 152..351 618 57.5 Plus
Dper\GL16412-PA 987 GL16412-PA 496..674 172..352 392 40.3 Plus
Dper\GL23716-PA 640 GL23716-PA 234..411 172..352 334 35.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 05:39:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22088-PA 345 GA22088-PA 1..345 1..353 1539 87.3 Plus
Dpse\GA20441-PA 220 GA20441-PA 22..219 152..351 618 57.5 Plus
Dpse\GA14764-PA 1037 GA14764-PA 547..725 172..352 393 40.3 Plus
Dpse\GA26713-PA 642 GA26713-PA 234..411 172..352 342 34.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 05:39:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15696-PA 352 GM15696-PA 1..352 1..353 1610 97.5 Plus
Dsec\GM16720-PA 224 GM16720-PA 15..223 141..351 611 54 Plus
Dsec\GM21561-PA 278 GM21561-PA 10..172 190..352 358 43 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 05:39:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25175-PA 352 GD25175-PA 1..352 1..353 1619 98 Plus
Dsim\GD23502-PA 224 GD23502-PA 15..223 141..351 612 54 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 05:39:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14917-PA 352 GJ14917-PA 1..352 1..353 1440 82.2 Plus
Dvir\Tbp-PA 351 GJ21317-PA 1..351 1..353 1438 81.7 Plus
Dvir\GJ17690-PA 220 GJ17690-PA 21..219 151..351 618 57.2 Plus
Dvir\GJ19385-PA 711 GJ19385-PA 243..453 147..352 408 37.1 Plus
Dvir\GJ17285-PA 387 GJ17285-PA 54..225 179..352 387 40.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 05:39:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10649-PA 351 GK10649-PA 1..351 1..353 1405 82.6 Plus
Dwil\GK15318-PA 226 GK15318-PA 29..225 154..351 612 58.1 Plus
Dwil\GK16294-PA 1222 GK16294-PA 683..905 137..352 399 36.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 05:39:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13685-PA 349 GE13685-PA 1..349 1..353 1647 98 Plus
Dyak\GE18732-PA 224 GE18732-PA 15..223 141..351 621 54 Plus
Dyak\GE15780-PA 1872 GE15780-PA 1438..1618 172..352 332 39.9 Plus

LD44083.hyp Sequence

Translation from 154 to 1215

> LD44083.hyp
MDQMLSPNFSIPSIGTPLHQMEADQQIVANPVYHPPAVSQPDSLMPAPGS
SSVQHQQQQQQSDASGGSGLFGHEPSLPLAHKQMQSYQPSASYQQQQQQQ
QLQSQAPGGGGSTPQSMMQPQTPQSMMAHMMPMSERSVGGSGAGGGGDAL
SNIHQTMGPSTPMTPATPGSADPGIVPQLQNIVSTVNLCCKLDLKKIALH
ARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEDDSRLAARK
YARIIQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHCNFSSYEPE
LFPGLIYRMVRPRIVLLIFVSGKVVLTGAKVRQEIYDAFDKIFPILKKFK
KQS*

LD44083.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:53:26
Subject Length Description Subject Range Query Range Score Percent Strand
Tbp-PA 353 CG9874-PA 1..353 1..353 1828 100 Plus
Trf-PA 224 CG7562-PA 22..223 148..351 586 55.9 Plus
Trf2-PJ 632 CG18009-PJ 204..377 179..352 350 41.5 Plus
Trf2-PH 632 CG18009-PH 204..377 179..352 350 41.5 Plus
Trf2-PI 1714 CG18009-PI 1286..1459 179..352 350 41.5 Plus