Clone LD45147 Report

Search the DGRC for LD45147

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:451
Well:47
Vector:pOT2
Associated Gene/TranscriptCG42699-RC
Protein status:LD45147.pep: gold
Sequenced Size:4292

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4064 2008-04-29 Release 5.5 accounting
CG15770 2008-04-29 Picked prior to 5.5
CG4064 2008-08-15 Release 5.9 accounting
CG15770 2008-08-15 Release 5.9 accounting
CG4064 2008-12-18 5.12 accounting
CG15770 2008-12-18 5.12 accounting

Clone Sequence Records

LD45147.complete Sequence

4292 bp assembled on 2007-09-19

GenBank Submission: BT030997

> LD45147.complete
ACAAAGTGGAGTGGGGTGTGGGTACTGCAAAAAGTGGTTAAAATGTTGTT
GCCACGGCCAAACTGACGATGCGCCGCGTCCGCTGAGCCTCGTGTCCGCA
TCCGTGAGATCCGTGATCCCCAGGTCCGAGCTCTGGGCACCCGGAAATTC
CCCAACGAGCACATAGTCCGGCTGTTTTCTGTTCGTTTTCAATTGGTTTG
CATTGATAGACCAGGCAAACCAAACAAACAAACAAACACACTGAAGCATC
GGGATTCTATATATATAAATAGAATAGAAACAGAAAAGTAGATAGACATC
CTCACTGGCCCCATTTGATTGCGGATCACATCAGCGCGCCATGTCGCAGG
TGCTTAGCCCCCACAAACAGGGCGTGTCGGAGGCGGATGCGTTGGACTAC
ACGAACAGCAGCTCGATCATCGAGTTCCTGGCCAAAGAGCAGGACTGCGG
CGGAATACTGAACGATCCGGACCCGGAGTCCATATTCCAGGAGGTGAGTC
GCCTGTCCGACAGCACAGATATGCGATCCGTGGATGAATTGCTGCAGGAA
GCGGAGCGCCTGATCCAACAGCAGTTGCGTCTCGGCGGTATTGTTCCAAA
ACTGGACGCTTCCGGGCCCCCTGCTCCGACCAAAACCCTCGGAGAAGAAG
CTGCCACCGGTGGTGATGGCTCTTCCTCATCCCCGCAGTCCTCGCCGCAT
AGCAGCATACGGCTGAATACACGCTATACCCATCGCATCGAGCATTCGCC
TGCTCCCTTGGCGCCAAAAACCGTCGCAGTCAATGGCAGAGTCCGGCCCA
GATCCGGTTCCAAATCGTCGGCCTCGCCAACATCGGTGCAGACGCCGCTA
GAAAGCAGCAATGGATGCGGCTTTGCCGCCTTCGTGGATAACCTGCCATC
GGCGTCGGTCATTTCCGAGGAGTCCACGCCCAAGGACATGGACATGGAGA
ACCATACGGCGGCCATGGCAAAGCTGCAACTCCAGCAGCTTCAGGATAAT
ACCGATGACGACGAGGATACGATGGAGGAGATCACCGAGGCGGAGGTGGA
CGCCCCCATATTTTCGCGAGCTGAGGACACTGGCAAAGAGGTCAGGAGTC
CGCCTGAAAGGCAGTTTAAGAGTCAAGGGCGTTCATACATCCAGCCCAGT
CAGCCGATTCGACCGATGGCCAGCTACAGCGAGAAGGCGGTGGGCAGCTC
ACCCAAGCGCATGGTCAGCACCTTGACCTCACCCATCGAGCAGATCGCCA
GTAGTGTTTCGCGGGAGCATGCGCTTAAGCTGGAGATCGAGCAACTGCAG
GAGCGACTCAAGGACACCGAGGAGCGTCTGGCCTCCGTTCGCCTTCAGAG
CGACTCGCTGTCGCAGACGCAACGTGCGCTGCGGGAGCACAACAGCCGGC
TGCAGGAGGAGTCCGAGATGCTAAAGCTGGACGTGCAGCATCTCAATGAG
TGCGCCAATGTCTTGAGGTCGGAACTGCAGGCGGCTCGCAGGGATCGTGG
CGAGGCGCTCCAGATGCAGCGCTCCCTGCGAGATGAACTCGAGGAGGCGA
ACCAGGAGCGGCGGCGAACTGGTGAGGGTAAAGAGAAGGACAGCCGCGTC
ATCCAGGATCTGCAACGCCAGTGCCGCGAGATGGAGCGCATACTGATGCG
CAAGCATCCGGACTCCGTGTCCGCTCTGATAGTGGCGTCCAAGAGTTCGG
GCATGTGTCCGCTTAACGACCAGGAGAACGTGAATAGTCGCAAACTGCTG
GAGCAGCGCATCGCCCAGCTCGAATCGGATGCCAAGGAGCAGGATCGCAA
GGCGCAACAGATTCTGGCCAATGTCCAGGCGCGCTTCAATTCGGTGCAGG
CCAAATATGAGACTCACATCGCGGACCTGGAGACGCAGGTTTTAAGCCTT
CAGGAGATAAACACAAAACTAAACGAGCAGATAGAATCACAGGTGCGCAC
CCTAGATCGGTATATGCAAAAGAGGGCGGATAGATACTACAACAATTGCA
CCCAAACTGAGCCATTAGAAGAGGATGATGTATCAGTCGGCGGTGGAGTA
AACCACGGACGAGCTACCCCGGTTAGCTCGAACACAATGGGCACCCAAAC
CCAGGCGGCGAATGGAACGCGGGATCATAGTACCAATACCATTGGCTGCC
CCTCGCCGGCACTTGTGTGCCAGCAGCAGCATCTCCACCAAGCGCATGGC
CACCTCCATCCACATGCCCCGTCCGCAAGCAGCAGCACCAGCAGCACCGC
CAATTCCACGCCGAACACGTCGCGTCCGAACTCGAAACAAAGTGGCGGTC
AAAGGCGTTCGCCACTGGTCACCGCGGGCCCCTCAAAGCTGCCCATCTCG
CAGTCGGACTCAACGCTCTCACTGCTCAGCCATGGCGGCGGAGGATCCAA
GGAGGAGGCACAGTTGCTCAGCTCCGTGAGGAGTATGCGCGTGGATCTGG
CCATTAAAAACAAGGCAATGCAGCGTTTAACACGGGAGTTGGATGAATGC
AAAAAGACCATACGGAAGCTGCAGCGGGACAAGGAGGGTAGTGGCTCCGG
CAGCCAAACAGGCAGCAAACTGGATCTAAGGTCCCAGGCTAGCGGCGGAG
CCATGCAGCAGAGGCGCTCCAGTGGCTATGATCACCATCACCACAGTGAT
CACATTCCGGCGGCCACCGAAAGTCAGGCTCTGAAGGAGGCCCAAAACAA
GTACCGTCTGCTGGAGGCCGACTATAAAACTCTTCATGACAAGCGGCTGC
AGGATCTGAAGACCCTGCAGAGTGCCCACGAAAGGGAACTGGCCTCCTGC
AACGAGACCGTGCGTATACTGCAGCAGCGCCTCAACGAGCGGGAGGAGGC
ACTGACCACCCAGAAGCGGCGCAAGGTGCCCGTGGATTACTATGCCCTGA
AAGCCAAGGTATCGCTTTTGGAAAGGAGGCACTCGGAGCGGGAGGAGAGA
CTTCATATGCTGGTGGAGGCACTCAGCAAGGGACGGCTCAACGGTGCTCT
CGAGGATCTGATGCAGGAGAACAACAACAAGTAGAGGAGTTCAAAGCGTT
TAGGATATTACTTAAGTCACATTGCCACGTTCAATGCCAGCCAATTCGAT
TAGAGTCCGTCTAAGCAGAAAAACATCCAATGATTAAAACAATTTTAGCC
AGAACAAAAAGCAGGGGTTGGTAGCAAAGGGTCCGAGCACTTGCTGCCAG
GTTGGATAGCGTCTCCGAAAGATCAAACTCTAACTGACGCACCTGCGATT
TTCTCAAACCAAATTCAAATGTGTTCAAAATGGAAACAATAAGTATATCG
ACAAGTGATCAGATAGCCAACCATTTATTTATAGGCTTAAGATCTTTCTC
AAAAATAGAGCAGCTATTCAATCTGGCGGCCAAGGTCAATCGGAATCCAT
TTCATGGCCCTTTGCTCACCAAGGATATTTAATGAAACAGAACTAGTTTA
AAGTTATTGTAGTTCTTAGAGCAGAATGTATTTTAAATATCAATGTTTCG
ATGTAGAAATTGAATGGTTTAAATCACGTTCACACAACTTAGAAAGAGAT
AGCGATGGCGGTGTGAAAGAGAGCGAGATAGTTGGAAGCTTCATGGAAAT
GAAAGAGAGGTAGTTTTTGGAAATGAAAGTTGTACTAGAAATAAGTATTT
TATGTATATAGAATATCGAAGTACAGAAATTCGAAGCGATCTCAACTTGA
ATATTATATATTTGATTTAGATAAAAAGGTGCTGTACGGGCACAATTAAT
TTTACCAACCTAGCAGTCGATTTTTTTTTTACCTAACCCAATTATTGTGC
GTTTATGATAGAGAACTTTGAAAAAGTTAAAAACAAACTAAGAACCAGGG
ACCGTAAATAAGGTTAATTTACACCCCTCTCCCCCTATCCTAAACTTCTG
AAATAGGCAGATATATAAGACTACAATATGCTACCTTGTCGACCACCTAT
ACAGAAAGTATAAATGTATTTCAAATCTTGATGACATACCGAAATTAAGA
ATGAACGAAATTCTATAGACATCTCAAAGAGTAGACGGTATTTCCTCGTA
AATTCTATTCTATAAGCAATGCAAAGTTCATCCAGTATTTATTATATATA
ACTTTTGTTAAAATTGACATTATTTTTGGATACTTAATGATTACCGAGTG
AATTTTCAAAATACTACGGTCCCTGTAAAAAGGAATAAAATGGAATAATA
TAGATCTCCCATAAGTAAAAACTCAAGCAGGCGGACAATTAAGACAAAAA
CCAAATAAAAATTCCCAGTATTCCAAAAAAAAAAAAAAAAAA

LD45147.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:35:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG4064.a 2270 CG4064.a 1..2270 1022..3291 11350 100 Plus
CG4064-RA 2089 CG4064-RA 1..2089 1022..3110 10445 100 Plus
CG15770-RA 1251 CG15770-RA 9..1029 1..1021 5105 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:46:37
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 5680620..5681992 2905..4274 6585 99 Plus
chrX 22417052 chrX 5656998..5658018 1..1021 5105 100 Plus
chrX 22417052 chrX 5676861..5677522 1021..1682 3310 100 Plus
chrX 22417052 chrX 5677874..5678541 1895..2562 3250 99.1 Plus
chrX 22417052 chrX 5677586..5677802 1680..1896 1085 100 Plus
chrX 22417052 chrX 5680049..5680245 2559..2755 985 100 Plus
chrX 22417052 chrX 5680308..5680463 2756..2911 780 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:46:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG42699-RC 2694 CG42699-PC 1..2694 341..3034 13470 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:41:01 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:46:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG42699-RC 4296 CG42699-RC 23..4296 1..4274 21370 100 Plus
CG15767-RA 1433 CG15767-RA 1..90 4185..4274 450 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:46:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG42699-PC 897 CG42699-PC 1..897 341..3031 3817 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:46:26
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 5788207..5789578 2905..4276 6860 100 Plus
X 23542271 X 5764575..5765595 1..1021 5105 100 Plus
X 23542271 X 5785455..5786122 1895..2562 3340 100 Plus
X 23542271 X 5784439..5785100 1021..1682 3310 100 Plus
X 23542271 X 5785164..5785380 1680..1896 1085 100 Plus
X 23542271 X 5787636..5787832 2559..2755 985 100 Plus
X 23542271 X 5787895..5788050 2756..2911 780 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:32:00
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 5796305..5797676 2905..4276 6860 100 Plus
X 23527363 X 5772673..5773693 1..1021 5105 100 Plus
X 23527363 X 5793553..5794220 1895..2562 3340 100 Plus
X 23527363 X 5792537..5793198 1021..1682 3310 100 Plus
X 23527363 X 5793262..5793478 1680..1896 1085 100 Plus
X 23527363 X 5795734..5795930 2559..2755 985 100 Plus
X 23527363 X 5795993..5796148 2756..2911 780 100 Plus
Blast to na_te.dros performed 2014-11-26 19:46:28
Subject Length Description Subject Range Query Range Score Percent Strand
gtwin 7411 gtwin GTWIN 7411bp 239..294 3322..3377 118 67.9 Plus
gtwin 7411 gtwin GTWIN 7411bp 7155..7210 3322..3377 118 67.9 Plus

LD45147.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:38:04 Download gff for LD45147.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 5680624..5681992 2909..4274 98   Plus
chrX 5680308..5680460 2756..2908 100 -> Plus
chrX 5680052..5680245 2562..2755 100 -> Plus
chrX 5677876..5678540 1897..2561 99 -> Plus
chrX 5677589..5677802 1683..1896 100 -> Plus
chrX 5676862..5677522 1022..1682 100 -> Plus
chrX 5656998..5658018 1..1021 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:46:54 Download gff for LD45147.complete
Subject Subject Range Query Range Percent Splice Strand
CG4064-RA 1..2013 1022..3034 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:05:07 Download gff for LD45147.complete
Subject Subject Range Query Range Percent Splice Strand
CG42699-RC 1..2694 341..3034 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:36:44 Download gff for LD45147.complete
Subject Subject Range Query Range Percent Splice Strand
CG42699-RC 1..2694 341..3034 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:51:26 Download gff for LD45147.complete
Subject Subject Range Query Range Percent Splice Strand
CG4064-RA 1..2013 1022..3034 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:38:04 Download gff for LD45147.complete
Subject Subject Range Query Range Percent Splice Strand
CG42699-RC 1..2694 341..3034 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:46:53 Download gff for LD45147.complete
Subject Subject Range Query Range Percent Splice Strand
CG4064-RA 1..2013 1022..3034 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:05:07 Download gff for LD45147.complete
Subject Subject Range Query Range Percent Splice Strand
CG42699-RC 1..4274 1..4274 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:36:44 Download gff for LD45147.complete
Subject Subject Range Query Range Percent Splice Strand
CG42699-RC 23..4296 1..4274 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:51:26 Download gff for LD45147.complete
Subject Subject Range Query Range Percent Splice Strand
CG4064-RA 1..2013 1022..3034 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:38:04 Download gff for LD45147.complete
Subject Subject Range Query Range Percent Splice Strand
CG42699-RC 23..4296 1..4274 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:38:04 Download gff for LD45147.complete
Subject Subject Range Query Range Percent Splice Strand
X 5788211..5789576 2909..4274 100   Plus
X 5787895..5788047 2756..2908 100 -> Plus
X 5787639..5787832 2562..2755 100 -> Plus
X 5785457..5786121 1897..2561 100 -> Plus
X 5785167..5785380 1683..1896 100 -> Plus
X 5784440..5785100 1022..1682 100 -> Plus
X 5764575..5765595 1..1021 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:36:44 Download gff for LD45147.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 5682244..5683609 2909..4274 100   Plus
arm_X 5681928..5682080 2756..2908 100 -> Plus
arm_X 5681672..5681865 2562..2755 100 -> Plus
arm_X 5679490..5680154 1897..2561 100 -> Plus
arm_X 5679200..5679413 1683..1896 100 -> Plus
arm_X 5678473..5679133 1022..1682 100 -> Plus
arm_X 5658608..5659628 1..1021 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:57:15 Download gff for LD45147.complete
Subject Subject Range Query Range Percent Splice Strand
X 5796309..5797674 2909..4274 100   Plus
X 5795993..5796145 2756..2908 100 -> Plus
X 5795737..5795930 2562..2755 100 -> Plus
X 5793555..5794219 1897..2561 100 -> Plus
X 5793265..5793478 1683..1896 100 -> Plus
X 5792538..5793198 1022..1682 100 -> Plus
X 5772673..5773693 1..1021 100 -> Plus

LD45147.pep Sequence

Translation from 340 to 3033

> LD45147.pep
MSQVLSPHKQGVSEADALDYTNSSSIIEFLAKEQDCGGILNDPDPESIFQ
EVSRLSDSTDMRSVDELLQEAERLIQQQLRLGGIVPKLDASGPPAPTKTL
GEEAATGGDGSSSSPQSSPHSSIRLNTRYTHRIEHSPAPLAPKTVAVNGR
VRPRSGSKSSASPTSVQTPLESSNGCGFAAFVDNLPSASVISEESTPKDM
DMENHTAAMAKLQLQQLQDNTDDDEDTMEEITEAEVDAPIFSRAEDTGKE
VRSPPERQFKSQGRSYIQPSQPIRPMASYSEKAVGSSPKRMVSTLTSPIE
QIASSVSREHALKLEIEQLQERLKDTEERLASVRLQSDSLSQTQRALREH
NSRLQEESEMLKLDVQHLNECANVLRSELQAARRDRGEALQMQRSLRDEL
EEANQERRRTGEGKEKDSRVIQDLQRQCREMERILMRKHPDSVSALIVAS
KSSGMCPLNDQENVNSRKLLEQRIAQLESDAKEQDRKAQQILANVQARFN
SVQAKYETHIADLETQVLSLQEINTKLNEQIESQVRTLDRYMQKRADRYY
NNCTQTEPLEEDDVSVGGGVNHGRATPVSSNTMGTQTQAANGTRDHSTNT
IGCPSPALVCQQQHLHQAHGHLHPHAPSASSSTSSTANSTPNTSRPNSKQ
SGGQRRSPLVTAGPSKLPISQSDSTLSLLSHGGGGSKEEAQLLSSVRSMR
VDLAIKNKAMQRLTRELDECKKTIRKLQRDKEGSGSGSQTGSKLDLRSQA
SGGAMQQRRSSGYDHHHHSDHIPAATESQALKEAQNKYRLLEADYKTLHD
KRLQDLKTLQSAHERELASCNETVRILQQRLNEREEALTTQKRRKVPVDY
YALKAKVSLLERRHSEREERLHMLVEALSKGRLNGALEDLMQENNNK*

LD45147.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 20:10:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21207-PA 662 GF21207-PA 1..662 228..897 2592 81.6 Plus
Dana\GF21206-PA 273 GF21206-PA 1..266 1..227 594 59.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 20:10:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18785-PA 678 GG18785-PA 14..678 231..897 2996 93.4 Plus
Dere\GG18784-PA 231 GG18784-PA 1..227 1..227 997 89.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 20:10:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24394-PA 689 GH24394-PA 1..689 228..897 2237 70.2 Plus
Dgri\GH24392-PA 272 GH24392-PA 46..271 17..227 398 47.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 20:10:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG42699-PC 897 CG42699-PC 1..897 1..897 4520 100 Plus
zip-PH 1964 CG15792-PH 851..1437 314..889 166 19.4 Plus
zip-PG 1971 CG15792-PG 843..1429 314..889 166 19.4 Plus
zip-PE 1971 CG15792-PE 843..1429 314..889 166 19.4 Plus
zip-PC 1971 CG15792-PC 843..1429 314..889 166 19.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 20:10:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15334-PA 690 GI15334-PA 49..690 267..897 2232 76.2 Plus
Dmoj\GI15333-PA 273 GI15333-PA 38..262 17..228 423 49.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 20:10:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15162-PA 695 GL15162-PA 41..695 228..897 2281 72.7 Plus
Dper\GL15161-PA 268 GL15161-PA 1..233 1..215 318 44.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 20:10:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17929-PA 665 GA17929-PA 1..665 228..897 2488 79.2 Plus
Dpse\GA13945-PA 282 GA13945-PA 1..270 1..228 497 50.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 20:10:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12436-PA 505 GM12436-PA 1..505 392..897 2252 98 Plus
Dsec\GM12435-PA 209 GM12435-PA 1..208 1..208 947 92.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 20:10:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16751-PA 586 GD16751-PA 1..517 228..744 2421 96.1 Plus
Dsim\GD16750-PA 229 GD16750-PA 1..227 1..227 1079 96 Plus
Dsim\GD16751-PA 586 GD16751-PA 531..586 842..897 231 98.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 20:10:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14771-PA 685 GJ14771-PA 1..685 228..897 2304 72.6 Plus
Dvir\GJ14770-PA 247 GJ14770-PA 37..246 16..228 434 52.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 20:10:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25152-PA 673 GK25152-PA 1..673 228..897 2143 71.6 Plus
Dwil\GK25151-PA 276 GK25151-PA 54..263 19..214 358 48.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 20:10:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16430-PA 702 GE16430-PA 32..702 228..897 3168 95.1 Plus
Dyak\GE16429-PA 235 GE16429-PA 1..226 1..227 936 88.1 Plus

LD45147.hyp Sequence

Translation from 340 to 3033

> LD45147.hyp
MSQVLSPHKQGVSEADALDYTNSSSIIEFLAKEQDCGGILNDPDPESIFQ
EVSRLSDSTDMRSVDELLQEAERLIQQQLRLGGIVPKLDASGPPAPTKTL
GEEAATGGDGSSSSPQSSPHSSIRLNTRYTHRIEHSPAPLAPKTVAVNGR
VRPRSGSKSSASPTSVQTPLESSNGCGFAAFVDNLPSASVISEESTPKDM
DMENHTAAMAKLQLQQLQDNTDDDEDTMEEITEAEVDAPIFSRAEDTGKE
VRSPPERQFKSQGRSYIQPSQPIRPMASYSEKAVGSSPKRMVSTLTSPIE
QIASSVSREHALKLEIEQLQERLKDTEERLASVRLQSDSLSQTQRALREH
NSRLQEESEMLKLDVQHLNECANVLRSELQAARRDRGEALQMQRSLRDEL
EEANQERRRTGEGKEKDSRVIQDLQRQCREMERILMRKHPDSVSALIVAS
KSSGMCPLNDQENVNSRKLLEQRIAQLESDAKEQDRKAQQILANVQARFN
SVQAKYETHIADLETQVLSLQEINTKLNEQIESQVRTLDRYMQKRADRYY
NNCTQTEPLEEDDVSVGGGVNHGRATPVSSNTMGTQTQAANGTRDHSTNT
IGCPSPALVCQQQHLHQAHGHLHPHAPSASSSTSSTANSTPNTSRPNSKQ
SGGQRRSPLVTAGPSKLPISQSDSTLSLLSHGGGGSKEEAQLLSSVRSMR
VDLAIKNKAMQRLTRELDECKKTIRKLQRDKEGSGSGSQTGSKLDLRSQA
SGGAMQQRRSSGYDHHHHSDHIPAATESQALKEAQNKYRLLEADYKTLHD
KRLQDLKTLQSAHERELASCNETVRILQQRLNEREEALTTQKRRKVPVDY
YALKAKVSLLERRHSEREERLHMLVEALSKGRLNGALEDLMQENNNK*

LD45147.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:18:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG42699-PC 897 CG42699-PC 1..897 1..897 4520 100 Plus
zip-PH 1964 CG15792-PH 851..1437 314..889 166 19.4 Plus
zip-PG 1971 CG15792-PG 843..1429 314..889 166 19.4 Plus
zip-PE 1971 CG15792-PE 843..1429 314..889 166 19.4 Plus
zip-PC 1971 CG15792-PC 843..1429 314..889 166 19.4 Plus