Clone LD46228 Report

Search the DGRC for LD46228

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:462
Well:28
Vector:pOT2
Associated Gene/TranscriptAef1-RA
Protein status:LD46228.pep: gold
Preliminary Size:2567
Sequenced Size:2588

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5683 2001-01-01 Release 2 assignment
CG5683 2001-07-04 Blastp of sequenced clone
CG5683 2003-01-01 Sim4 clustering to Release 3
Aef1 2008-04-29 Release 5.5 accounting
Aef1 2008-08-15 Release 5.9 accounting
Aef1 2008-12-18 5.12 accounting

Clone Sequence Records

LD46228.complete Sequence

2588 bp (2588 high quality bases) assembled on 2001-07-04

GenBank Submission: AY060435

> LD46228.complete
TACGTGTGTGCGCTAGTGATGTCCATACGTGTGTGCGACTGAAAGTGGTT
GTGACTTTTAGCTGAAGAAGGGAGCGCGAGGGGCGATCTAGAGGCAACGT
GTTAGTGGAAAAACTGCTTTTGAAAAAAGGGGAAAATATCCCCCAAAAAG
CCCGCCCAAAAAAGGCACTAGCAGCAACAACATCAGAGAAGCGCCCAAGA
TGAGCATGTCGTGGCATTTTTGAAGCATCGATCTTAGTTTGTTAGCCAGC
TTTCTGTTCAAGTCACCGAGGTACCGCAGTCTCCCTCCACTATTCCACCA
GATTCAAATCCAGCTTCGAATCCCGAATCCAGACTACCTAATCCCAGCAA
GAGCAGTCCATGATGCATATCAAAAGCCTGCCCCATGCCCATGCCGCTGC
TACGGCGATGAGCAGTAACTGCGACATTGTCATAGTGGCCGCCCAGCCCC
AAACCACCATAGCAAACAATAATAACAATGAGACGGTCACCCAGGCCACG
CATCCGGCTCACATGGCGGCGGTTCAACAGCAGCAGCAACAACAACAGCA
ACAGCAGCAGCAACATCATCAGCAGCAGCAACAGCAGTCGAGCGGACCAC
CCTCTGTGCCGCCGCCACCCACGGAACTCCCCTTGCCCTTCCAGATGCAC
TTAAGCGGGATCTCGGCGGAGGCGCATAGTGCCGCCCAAGCAGCGGCTAT
GGCAGCTGCCCAAGCTGCAGCAGCCCAAGCTGCTGCGGCGGAACAACAGC
AACCGCCGCCACCAACTTCACATCTGACGCACCTGACCACGCATAGTCCG
ACAACGATCCACAGTGAGCATTACCTGGCCAATGGACATAGCGAGCATCC
CGGAGAGGGCAACGCTGCCGTTGGCGTAGGGGGAGCTGTCCGCGAGCCGG
AGAAACCTTTCCACTGCACCGTCTGCGATCGTCGCTTTCGACAGCTAAGC
ACACTGACCAACCATGTAAAGATCCATACTGGCGAGAAGCCCTACAAATG
CAACGTTTGTGATAAGACCTTCCGTCAATCGTCGACGCTGACGAACCATC
TGAAGATCCATACGGGCGAGAAGCCTTATAACTGCAACTTTTGTCCCAAG
CATTTTCGACAACTGAGCACGCTGGCCAACCATGTGAAGATCCACACGGG
TGAAAAGCCTTTTGAGTGTGTCATCTGCAAGAAGCAGTTCCGACAGTCCA
GCACGCTCAACAACCACATAAAAATACACGTCATGGACAAAGTCTACGTT
CCTGTTAAGATCAAAACAGAGGAGGATGAGGGGTGACTAGGACGAATGCC
GTTGGCGGCGCACCACCATCAGCAGCAGCAACACCAGCACCACCATCAAC
AGCAGCAGCATCAGCACCACCCGCCGCCTCCGTCCCAGCAGCAGCAGCAG
CATATCGATCAGCGTGGAGTCACCATAACCACGTTGCCCTCCGCCACGAC
AGTGGCCCAACATCACCAGCAGCATCAGCACATTCAGGATGGCTCGCCGC
ACCATCATTTTAATGTGGCCGCTCTAGGGGACTTATCCAGCGCTATGCAA
TTGGGCGCTGTGACGGCGGACGGGAGCTTTGTGACCATGGGCGGTGTTGT
GGTGGGTCGCATCCAGCACACACGAGAGGAACTGCAGCAGCTTGGAGTGA
TCAAGGTGGAGTCACCATCGAATGGTGGCACAGCCACGACGTCAGCGACG
GCGGAAACGCAACGCGAGGGATGAGTCGATGAGCTGCTCCTCGAGTACAT
GCTCAAGGAGGAGAATGCGGATGAAGAGGATGAACAGGAGCATGAGTCGG
AAGTGGATGCGGATGTAGTGGAAATTCAGGAGCAGAAAGAGGAGCAGCGA
TCGAGCCAGAAGTGAGCCATGTTTGGTGTGTACGCTTACGTTGTTGTTAG
TTGTTTAATTGTAGCGAACATTGTTGTTGTTGTTAAGGTTTAAATGTGTG
ACTAAGAACTTACCAAGATGATTGTATAGCAAACGCTTCAAAAGTAGGTA
AACGAAAGGCGCCGACACCAGCACCCAGAGCTCCCAAAAAAATAACACAA
ACCGTAAACAAAAACAGAAACAAAAATACTAAAATAATAGTAAAGCTAAA
CTAAAAACCAGATGAAAGACCTTTGCAGAGAGTTGTCTCTATAGCAGCGC
ACCCCATCTCACATTCACAACCCTCTCAGCCCCGGAAATAGATTAAACCC
CTCTCTACTCACTTATAAAATAACCTAACCCTAACTAGAGTGAAAATAGT
TTGCTAATAGCAAGAGCAAACTAAACCCAAAAGGCAAAAAGCATTACGTG
TACGAAGAACTTAATTAAAATATTTCCCAAAGTGCAACCCGTTTCAGATT
GTAAATTGTTGACCCGACTCACTTTTAAGTTGTTTAATTTAGCATTTAAA
GCTTAAGAAAAATTGTTGTACAACTCAAAGTTGGTGACGTTTTTCGCCAT
CTTGCAAGGGCGTGTTTTAGTCTGGGCTAACACAAATACAATTTGTTTAT
AAAATCAATAGCTTAATTATTTAACTTCGTAAACTTGTCAGCAAAACTTA
AAAAAATATCCTGAACAGAAAAAAAAAAAAAAAAAAAA

LD46228.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:28:16
Subject Length Description Subject Range Query Range Score Percent Strand
Aef1-RB 3226 Aef1-RB 88..2659 1..2572 12860 100 Plus
Aef1.d 3803 Aef1.d 88..2659 1..2572 12860 100 Plus
Aef1-RA 3357 Aef1-RA 343..2754 161..2572 12060 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:37:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 21425032..21426451 1149..2568 7100 100 Plus
chr3L 24539361 chr3L 21423983..21424973 163..1153 4955 100 Plus
chr3L 24539361 chr3L 21422844..21423008 1..165 825 100 Plus
chr3L 24539361 chr3L 21424774..21424897 1038..1161 215 78.2 Plus
chr3L 24539361 chr3L 21424858..21424974 954..1070 195 77.8 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:37:49
Subject Length Description Subject Range Query Range Score Percent Strand
Aef1-RD 1365 CG5683-PD 1..1365 360..1724 6825 100 Plus
Aef1-RB 927 CG5683-PB 1..927 360..1286 4635 100 Plus
Aef1-RC 927 CG5683-PC 1..927 360..1286 4635 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:42:30 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:37:48
Subject Length Description Subject Range Query Range Score Percent Strand
Aef1-RB 2579 CG5683-RB 12..2579 1..2568 12840 100 Plus
Aef1-RD 2684 CG5683-RD 277..2684 161..2568 12040 100 Plus
Aef1-RA 3826 CG5683-RA 271..2678 161..2568 12040 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:37:53
Subject Length Description Subject Range Query Range Score Percent Strand
Aef1-PD 454 CG5683-PD 3..454 366..1721 1512 99.8 Plus
Aef1-PB 308 CG5683-PB 3..308 366..1283 1083 100 Plus
Aef1-PC 308 CG5683-PC 3..308 366..1283 1083 100 Plus
Aef1-PA 308 CG5683-PA 3..308 366..1283 1083 100 Plus
CG4360-PA 556 CG4360-PA 472..555 897..1148 352 67.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:37:45
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21436072..21437495 1149..2572 7120 100 Plus
3L 28110227 3L 21435023..21436013 163..1153 4955 100 Plus
3L 28110227 3L 21433884..21434048 1..165 825 100 Plus
3L 28110227 3L 21435814..21435937 1038..1161 215 78.2 Plus
3L 28110227 3L 21435898..21436014 954..1070 195 77.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:50:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 21429172..21430595 1149..2572 7120 100 Plus
3L 28103327 3L 21428123..21429113 163..1153 4955 100 Plus
3L 28103327 3L 21426984..21427148 1..165 825 100 Plus
Blast to na_te.dros performed 2014-11-26 19:37:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Uvir 6564 Dvir\Uvir VIRUVIR 6564bp 5679..5733 2395..2449 122 69.1 Plus

LD46228.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 20:43:40 Download gff for LD46228.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 21426004..21426451 2121..2568 100   Plus
chr3L 21425731..21425918 1848..2035 100 == Plus
chr3L 21425286..21425638 1403..1755 100 == Plus
chr3L 21425033..21425202 1150..1319 100 == Plus
chr3L 21424407..21424969 587..1149 100 -> Plus
chr3L 21423985..21424344 165..524 100 == Plus
chr3L 21422844..21423007 1..164 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:29:43 Download gff for LD46228.complete
Subject Subject Range Query Range Percent Splice Strand
Aef1-RB 1..927 360..1286 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:15:26 Download gff for LD46228.complete
Subject Subject Range Query Range Percent Splice Strand
Aef1-RB 1..927 360..1286 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 22:15:37 Download gff for LD46228.complete
Subject Subject Range Query Range Percent Splice Strand
Aef1-RD 1..1365 360..1724 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:46:52 Download gff for LD46228.complete
Subject Subject Range Query Range Percent Splice Strand
Aef1-RB 1..927 360..1286 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:43:40 Download gff for LD46228.complete
Subject Subject Range Query Range Percent Splice Strand
Aef1-RD 1..1365 360..1724 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:09:12 Download gff for LD46228.complete
Subject Subject Range Query Range Percent Splice Strand
Aef1-RB 1..2568 1..2568 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:15:26 Download gff for LD46228.complete
Subject Subject Range Query Range Percent Splice Strand
Aef1-RB 1..2568 1..2568 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 22:15:37 Download gff for LD46228.complete
Subject Subject Range Query Range Percent Splice Strand
Aef1-RB 12..2579 1..2568 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:46:52 Download gff for LD46228.complete
Subject Subject Range Query Range Percent Splice Strand
Aef1-RB 1..2568 1..2568 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:43:40 Download gff for LD46228.complete
Subject Subject Range Query Range Percent Splice Strand
Aef1-RB 12..2579 1..2568 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 20:43:40 Download gff for LD46228.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21436073..21437491 1150..2568 100   Plus
3L 21435025..21436009 165..1149 100 -> Plus
3L 21433884..21434047 1..164 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 22:15:37 Download gff for LD46228.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21429173..21430591 1150..2568 100   Plus
arm_3L 21428125..21429109 165..1149 100 -> Plus
arm_3L 21426984..21427147 1..164 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:24:46 Download gff for LD46228.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21429173..21430591 1150..2568 100   Plus
3L 21428125..21429109 165..1149 100 -> Plus
3L 21426984..21427147 1..164 100 -> Plus

LD46228.pep Sequence

Translation from 359 to 1285

> LD46228.pep
MMHIKSLPHAHAAATAMSSNCDIVIVAAQPQTTIANNNNNETVTQATHPA
HMAAVQQQQQQQQQQQQQHHQQQQQQSSGPPSVPPPPTELPLPFQMHLSG
ISAEAHSAAQAAAMAAAQAAAAQAAAAEQQQPPPPTSHLTHLTTHSPTTI
HSEHYLANGHSEHPGEGNAAVGVGGAVREPEKPFHCTVCDRRFRQLSTLT
NHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPYNCNFCPKHFR
QLSTLANHVKIHTGEKPFECVICKKQFRQSSTLNNHIKIHVMDKVYVPVK
IKTEEDEG*

LD46228.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 15:04:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10284-PA 428 GF10284-PA 1..297 2..297 931 85.4 Plus
Dana\GF18117-PA 609 GF18117-PA 468..577 181..290 347 47.3 Plus
Dana\GF23213-PA 564 GF23213-PA 480..563 180..263 337 66.7 Plus
Dana\GF23446-PA 810 GF23446-PA 497..619 176..296 328 46.3 Plus
Dana\GF13861-PA 559 GF13861-PA 338..470 172..296 324 43.6 Plus
Dana\GF13861-PA 559 GF13861-PA 383..498 181..296 323 49.1 Plus
Dana\GF18117-PA 609 GF18117-PA 441..555 182..296 317 43.5 Plus
Dana\GF23213-PA 564 GF23213-PA 132..218 176..262 317 65.5 Plus
Dana\GF13861-PA 559 GF13861-PA 411..520 181..290 311 49.1 Plus
Dana\GF23213-PA 564 GF23213-PA 481..562 209..290 295 59.8 Plus
Dana\GF23213-PA 564 GF23213-PA 271..358 176..263 288 60.2 Plus
Dana\GF23213-PA 564 GF23213-PA 161..335 177..296 281 38.3 Plus
Dana\GF23213-PA 564 GF23213-PA 277..357 210..290 258 59.3 Plus
Dana\GF23213-PA 564 GF23213-PA 475..540 231..296 198 53 Plus
Dana\GF23213-PA 564 GF23213-PA 137..196 237..296 174 53.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 15:04:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16184-PA 307 GG16184-PA 1..307 2..308 1147 97.1 Plus
Dere\GG15533-PA 554 GG15533-PA 444..553 153..263 352 56.6 Plus
Dere\GG16477-PA 603 GG16477-PA 462..571 181..290 347 47.3 Plus
Dere\GG21465-PA 560 GG21465-PA 339..471 172..296 330 44.4 Plus
Dere\GG13168-PA 926 GG13168-PA 512..634 176..296 330 46.3 Plus
Dere\GG21465-PA 560 GG21465-PA 384..499 181..296 324 49.1 Plus
Dere\GG15533-PA 554 GG15533-PA 132..218 176..262 320 65.5 Plus
Dere\GG16477-PA 603 GG16477-PA 365..549 127..296 318 34 Plus
Dere\GG21465-PA 560 GG21465-PA 412..521 181..290 310 49.1 Plus
Dere\GG15533-PA 554 GG15533-PA 272..359 176..263 291 60.2 Plus
Dere\GG15533-PA 554 GG15533-PA 161..336 177..296 284 38.1 Plus
Dere\GG15533-PA 554 GG15533-PA 278..358 210..290 261 59.3 Plus
Dere\GG21465-PA 560 GG21465-PA 350..444 203..297 232 44.2 Plus
Dere\GG15533-PA 554 GG15533-PA 463..530 229..296 204 52.9 Plus
Dere\GG15533-PA 554 GG15533-PA 137..196 237..296 177 53.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 15:04:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16881-PA 332 GH16881-PA 2..332 19..308 834 72.6 Plus
Dgri\GH19229-PA 597 GH19229-PA 454..563 181..290 348 47.3 Plus
Dgri\GH17975-PA 553 GH17975-PA 454..552 167..263 345 59.6 Plus
Dgri\GH14387-PA 213 GH14387-PA 118..211 171..262 343 63.8 Plus
Dgri\GH10428-PA 799 GH10428-PA 435..553 181..299 340 49.6 Plus
Dgri\GH17975-PA 553 GH17975-PA 119..206 175..262 318 64.8 Plus
Dgri\GH14387-PA 213 GH14387-PA 122..211 201..290 297 56.7 Plus
Dgri\GH17975-PA 553 GH17975-PA 462..552 201..291 296 56 Plus
Dgri\GH17975-PA 553 GH17975-PA 125..217 209..301 293 59.1 Plus
Dgri\GH17975-PA 553 GH17975-PA 271..355 179..263 284 61.2 Plus
Dgri\GH17975-PA 553 GH17975-PA 274..355 210..291 259 58.5 Plus
Dgri\GH19229-PA 597 GH19229-PA 427..513 210..296 240 46 Plus
Dgri\GH17975-PA 553 GH17975-PA 455..529 222..296 204 50.7 Plus
Dgri\GH14387-PA 213 GH14387-PA 122..189 229..296 200 51.5 Plus
Dgri\GH17975-PA 553 GH17975-PA 274..333 238..297 163 51.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:04:14
Subject Length Description Subject Range Query Range Score Percent Strand
Aef1-PB 308 CG5683-PB 1..308 1..308 1653 100 Plus
Aef1-PC 308 CG5683-PC 1..308 1..308 1653 100 Plus
Aef1-PA 308 CG5683-PA 1..308 1..308 1653 100 Plus
Aef1-PD 454 CG5683-PD 1..308 1..308 1653 100 Plus
odd-PA 392 CG3851-PA 65..326 39..290 372 35.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 15:04:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12025-PA 350 GI12025-PA 119..350 84..308 815 83 Plus
Dmoj\GI24263-PA 604 GI24263-PA 469..578 181..290 349 47.3 Plus
Dmoj\GI24888-PA 214 GI24888-PA 119..212 171..262 347 63.8 Plus
Dmoj\GI10549-PA 566 GI10549-PA 459..565 153..263 344 56.8 Plus
Dmoj\GI23506-PA 777 GI23506-PA 439..551 181..293 336 49.6 Plus
Dmoj\GI10549-PA 566 GI10549-PA 143..230 175..262 319 64.8 Plus
Dmoj\GI24888-PA 214 GI24888-PA 123..212 201..290 299 57.8 Plus
Dmoj\GI10549-PA 566 GI10549-PA 475..565 201..291 296 56 Plus
Dmoj\GI10549-PA 566 GI10549-PA 149..241 209..301 293 59.1 Plus
Dmoj\GI10549-PA 566 GI10549-PA 293..377 179..263 285 61.2 Plus
Dmoj\GI10549-PA 566 GI10549-PA 296..377 210..291 258 58.5 Plus
Dmoj\GI24263-PA 604 GI24263-PA 442..528 210..296 241 46 Plus
Dmoj\GI24888-PA 214 GI24888-PA 109..190 215..296 203 46.3 Plus
Dmoj\GI10549-PA 566 GI10549-PA 475..542 229..296 203 52.9 Plus
Dmoj\GI10549-PA 566 GI10549-PA 205..355 181..297 192 35.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 15:04:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24688-PA 325 GL24688-PA 1..325 2..308 980 80.7 Plus
Dper\GL24097-PA 564 GL24097-PA 445..563 152..263 356 55.7 Plus
Dper\GL23194-PA 592 GL23194-PA 460..569 181..290 348 47.3 Plus
Dper\GL25186-PA 884 GL25186-PA 457..579 176..296 326 46.3 Plus
Dper\GL23194-PA 592 GL23194-PA 414..547 162..296 324 40.7 Plus
Dper\GL26169-PA 557 GL26169-PA 334..468 170..296 323 43 Plus
Dper\GL26169-PA 557 GL26169-PA 381..496 181..296 323 49.1 Plus
Dper\GL24097-PA 564 GL24097-PA 125..212 175..262 319 64.8 Plus
Dper\GL26169-PA 557 GL26169-PA 409..518 181..290 310 49.1 Plus
Dper\GL24097-PA 564 GL24097-PA 473..563 201..291 299 56 Plus
Dper\GL24097-PA 564 GL24097-PA 273..360 176..263 289 60.2 Plus
Dper\GL24097-PA 564 GL24097-PA 279..360 210..291 259 58.5 Plus
Dper\GL24097-PA 564 GL24097-PA 473..540 229..296 203 52.9 Plus
Dper\GL24097-PA 564 GL24097-PA 187..338 181..297 194 33.6 Plus
Dper\GL24097-PA 564 GL24097-PA 131..191 237..297 176 52.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 15:04:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19053-PA 321 GA19053-PA 1..321 2..308 984 81.4 Plus
Dpse\GA18132-PA 564 GA18132-PA 445..563 152..263 356 55.7 Plus
Dpse\GA20515-PA 592 GA20515-PA 460..569 181..290 348 47.3 Plus
Dpse\GA20515-PA 592 GA20515-PA 414..547 162..296 324 40.7 Plus
Dpse\GA20515-PB 555 GA20515-PB 414..547 162..296 324 40.7 Plus
Dpse\GA14887-PA 557 GA14887-PA 334..468 170..296 323 43 Plus
Dpse\GA18132-PA 564 GA18132-PA 125..212 175..262 319 64.8 Plus
Dpse\GA20515-PB 555 GA20515-PB 460..552 181..273 304 48.4 Plus
Dpse\GA18132-PA 564 GA18132-PA 467..563 198..291 299 53.6 Plus
Dpse\GA18132-PA 564 GA18132-PA 273..360 176..263 289 60.2 Plus
Dpse\GA18132-PA 564 GA18132-PA 279..360 210..291 259 58.5 Plus
Dpse\GA18132-PA 564 GA18132-PA 473..540 229..296 203 52.9 Plus
Dpse\GA18132-PA 564 GA18132-PA 187..338 181..297 194 33.6 Plus
Dpse\GA18132-PA 564 GA18132-PA 131..191 237..297 176 52.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 15:04:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22367-PA 309 GM22367-PA 1..309 2..308 1212 92.6 Plus
Dsec\GM23199-PA 554 GM23199-PA 444..553 153..263 353 56.6 Plus
Dsec\GM18708-PA 604 GM18708-PA 462..571 181..290 347 47.3 Plus
Dsec\GM16114-PA 561 GM16114-PA 340..472 172..296 330 44.4 Plus
Dsec\GM22079-PA 964 GM22079-PA 549..671 176..296 330 46.3 Plus
Dsec\GM23199-PA 554 GM23199-PA 132..218 176..262 325 66.7 Plus
Dsec\GM16114-PA 561 GM16114-PA 385..500 181..296 324 49.1 Plus
Dsec\GM18708-PA 604 GM18708-PA 435..549 182..296 316 43.5 Plus
Dsec\GM16114-PA 561 GM16114-PA 413..522 181..290 311 49.1 Plus
Dsec\GM23199-PA 554 GM23199-PA 463..552 201..290 299 56.7 Plus
Dsec\GM23199-PA 554 GM23199-PA 272..359 176..263 294 61.4 Plus
Dsec\GM23199-PA 554 GM23199-PA 161..336 177..296 280 37.5 Plus
Dsec\GM23199-PA 554 GM23199-PA 278..358 210..290 257 58 Plus
Dsec\GM23199-PA 554 GM23199-PA 463..530 229..296 203 52.9 Plus
Dsec\GM23199-PA 554 GM23199-PA 137..196 237..296 177 53.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 15:04:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14959-PA 309 GD14959-PA 1..309 2..308 1141 92.9 Plus
Dsim\GD20072-PA 548 GD20072-PA 438..547 153..263 349 55.8 Plus
Dsim\GD20175-PA 604 GD20175-PA 462..571 181..290 346 47.3 Plus
Dsim\GD12054-PA 886 GD12054-PA 478..600 176..296 333 46.3 Plus
Dsim\GD20072-PA 548 GD20072-PA 126..212 176..262 320 65.5 Plus
Dsim\GD20175-PA 604 GD20175-PA 435..549 182..296 316 43.5 Plus
Dsim\GD23730-PA 750 GD23730-PA 388..499 181..292 312 48.2 Plus
Dsim\GD12054-PA 886 GD12054-PA 507..625 175..291 300 43.7 Plus
Dsim\GD20072-PA 548 GD20072-PA 266..353 176..263 294 61.4 Plus
Dsim\GD20072-PA 548 GD20072-PA 155..330 177..296 280 37.5 Plus
Dsim\GD20072-PA 548 GD20072-PA 272..352 210..290 257 58 Plus
Dsim\GD20072-PA 548 GD20072-PA 457..524 229..296 203 52.9 Plus
Dsim\GD20072-PA 548 GD20072-PA 131..190 237..296 177 53.3 Plus
Dsim\GD12054-PA 886 GD12054-PA 298..384 165..239 161 40.2 Plus
Dsim\GD12054-PA 886 GD12054-PA 321..384 204..267 156 45.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 15:04:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13294-PA 336 GJ13294-PA 106..336 84..308 814 81.5 Plus
Dvir\gl-PA 598 GJ10836-PA 339..561 85..290 350 32.9 Plus
Dvir\GJ22905-PA 555 GJ22905-PA 448..554 153..263 345 56.8 Plus
Dvir\GJ20712-PA 735 GJ20712-PA 419..531 181..293 338 50.4 Plus
Dvir\GJ15143-PA 584 GJ15143-PA 408..523 181..296 326 50 Plus
Dvir\GJ22905-PA 555 GJ22905-PA 132..219 175..262 319 64.8 Plus
Dvir\GJ20712-PA 735 GJ20712-PA 390..506 180..296 307 44.4 Plus
Dvir\GJ22905-PA 555 GJ22905-PA 464..554 201..291 297 56 Plus
Dvir\GJ22905-PA 555 GJ22905-PA 138..230 209..301 294 59.1 Plus
Dvir\GJ22905-PA 555 GJ22905-PA 282..366 179..263 285 61.2 Plus
Dvir\GJ20712-PA 735 GJ20712-PA 307..422 182..296 264 39.7 Plus
Dvir\GJ22905-PA 555 GJ22905-PA 285..366 210..291 259 58.5 Plus
Dvir\GJ20712-PA 735 GJ20712-PA 278..387 181..290 257 42.7 Plus
Dvir\gl-PA 598 GJ10836-PA 425..511 210..296 241 46 Plus
Dvir\GJ20712-PA 735 GJ20712-PA 277..363 208..294 205 37.9 Plus
Dvir\GJ22905-PA 555 GJ22905-PA 464..531 229..296 203 52.9 Plus
Dvir\GJ22905-PA 555 GJ22905-PA 194..344 181..297 193 35.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 15:05:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20477-PA 451 GK20477-PA 1..298 1..297 946 76 Plus
Dwil\GK22737-PA 609 GK22737-PA 525..608 180..263 348 69 Plus
Dwil\GK11495-PA 620 GK11495-PA 481..590 181..290 348 47.3 Plus
Dwil\GK15349-PA 566 GK15349-PA 390..505 181..296 323 49.1 Plus
Dwil\GK22737-PA 609 GK22737-PA 141..229 174..262 322 62.9 Plus
Dwil\GK11495-PA 620 GK11495-PA 425..568 156..296 321 39.6 Plus
Dwil\GK14669-PA 673 GK14669-PA 412..521 181..290 321 50 Plus
Dwil\GK15349-PA 566 GK15349-PA 361..477 180..296 315 46.2 Plus
Dwil\GK15349-PA 566 GK15349-PA 418..527 181..290 312 49.1 Plus
Dwil\GK22737-PA 609 GK22737-PA 520..608 203..291 302 57.3 Plus
Dwil\GK22737-PA 609 GK22737-PA 148..240 209..301 294 58.1 Plus
Dwil\GK22737-PA 609 GK22737-PA 289..373 179..263 287 62.4 Plus
Dwil\GK22737-PA 609 GK22737-PA 292..373 210..291 256 57.3 Plus
Dwil\GK15349-PA 566 GK15349-PA 356..450 203..297 230 44.2 Plus
Dwil\GK22737-PA 609 GK22737-PA 204..351 181..297 213 36.5 Plus
Dwil\GK22737-PA 609 GK22737-PA 520..585 231..296 205 54.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 15:05:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23043-PA 329 GE23043-PA 19..329 1..308 1151 90.4 Plus
Dyak\GE19756-PA 311 GE19756-PA 1..311 2..308 1136 90.7 Plus
Dyak\GE25080-PA 554 GE25080-PA 439..553 157..263 348 55.7 Plus
Dyak\GE25205-PA 599 GE25205-PA 459..568 181..290 346 47.3 Plus
Dyak\GE12967-PA 561 GE12967-PA 340..472 172..296 325 43.6 Plus
Dyak\GE25080-PA 554 GE25080-PA 132..218 176..262 320 65.5 Plus
Dyak\GE25205-PA 599 GE25205-PA 362..546 127..296 318 34 Plus
Dyak\GE25080-PA 554 GE25080-PA 463..553 201..291 299 56 Plus
Dyak\GE25080-PA 554 GE25080-PA 272..359 176..263 294 61.4 Plus
Dyak\GE25080-PA 554 GE25080-PA 161..337 177..297 280 37.3 Plus
Dyak\GE25080-PA 554 GE25080-PA 278..359 210..291 257 57.3 Plus
Dyak\GE25080-PA 554 GE25080-PA 463..530 229..296 203 52.9 Plus
Dyak\GE25080-PA 554 GE25080-PA 137..197 237..297 177 52.5 Plus

LD46228.hyp Sequence

Translation from 359 to 1285

> LD46228.hyp
MMHIKSLPHAHAAATAMSSNCDIVIVAAQPQTTIANNNNNETVTQATHPA
HMAAVQQQQQQQQQQQQQHHQQQQQQSSGPPSVPPPPTELPLPFQMHLSG
ISAEAHSAAQAAAMAAAQAAAAQAAAAEQQQPPPPTSHLTHLTTHSPTTI
HSEHYLANGHSEHPGEGNAAVGVGGAVREPEKPFHCTVCDRRFRQLSTLT
NHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPYNCNFCPKHFR
QLSTLANHVKIHTGEKPFECVICKKQFRQSSTLNNHIKIHVMDKVYVPVK
IKTEEDEG*

LD46228.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:16:49
Subject Length Description Subject Range Query Range Score Percent Strand
Aef1-PB 308 CG5683-PB 1..308 1..308 1653 100 Plus
Aef1-PC 308 CG5683-PC 1..308 1..308 1653 100 Plus
Aef1-PA 308 CG5683-PA 1..308 1..308 1653 100 Plus
Aef1-PD 454 CG5683-PD 1..308 1..308 1653 100 Plus
odd-PA 392 CG3851-PA 65..326 39..290 372 35.4 Plus