Clone LD46373 Report

Search the DGRC for LD46373

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:463
Well:73
Vector:pOT2
Associated Gene/TranscriptCG1637-RA
Protein status:LD46373.pep: gold
Sequenced Size:1716

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1637-RA 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

LD46373.complete Sequence

1716 bp assembled on 2010-12-09

GenBank Submission: BT125840.1

> LD46373.complete
ATATTTCCATATTAGTGCTCATTTTTTGTTGTTCCCGCAAGCGAATTTGT
CGATTCCCCCGTTTAACTCCAACGACTCCCCGAGCCAAGTGTCCCCACTT
TGACAACGACGCAATTGTGATTTGGCAATGTTTTTGCTGACTGCGTTACT
GTGCAACAACAAACACAAGTAAATACAAAACGGTAAAAATGCAGAGACTG
CAATTCGCTCTGCTAGCGTCGCTGCTCCTGCTGGTGCTGCTTCTTCCGGG
GATTAGGAGCACTCCCATCGACCAGGACGTCGACATTGTTCACTATCAGC
CGGAGCAAGTGCATCTGTCCTTTGGAGAAACCGTGCTCGACATTGTCGTC
ACCTGGAACACGCGCGACAACACCAACGAATCAATCTGTGAGTTCGGCAT
CGATGGACTGCATCAGCGAGTGAAGGCGACGCAAATGCCCACGAAATTCG
TGGATGGTGGAGCCAAAAAGGCCACCCAGTATATACATCGTGTGACGCTG
TCCCACCTGAAACCGAATAGCACCTATCTCTACCACTGTGGCAGTGAGTT
GGGCTGGTCCGCCACCTATTGGTTTCGGACGCGATTCGATCACGCCGACT
GGTCGCCCTCGTTGGCGATCTACGGCGATATGGGCGTGGTGAATGCGGCA
TCCCTTCCAGCGCTGCAGCGTGAAACGCAGAGCGGCCAGTACGACGCCAT
CATCCATGTGGGAGACTTCGCCTACGACATGGACTGGGAAAACGGAGAGG
TCGGCGACGAGTTTATGCGCCAGGTGGAGACCATAGCCGCCTACTTACCA
TATATGGTGTGCGTGGGCAACCACGAGGAGAAGTACAACTTTTCGCACTA
CATCAATCGGTTCAGCATGCCGGGTGGATCGGATAACATGTTCTATAGCT
TCGATCTTGGACCGGTGCACTTCATCGGTTTTAGCACAGAAGTCTATTAT
TTCACTAAGTTCGGGATCAAGCAGATCGTGATGCAGTACGACTGGCTGGA
GCGGGATTTGATCGAGGCCAACAAGCCAGAAAACCGGAAGAAGCGTCCCT
GGATTATCACATACGGCCATCGGCCCATGTACTGCAGCAATGACAACGGA
GATGACTGTGCCAATCATGAGACAATCGTTCGAAAGGGTCTGCCCATGCT
GGATTTCTTCGGGCTGGAGCCACTCTTTTATCAGTACGGCGTAGATATTG
AATTGTGGGCACACGAGCACTGCTACGAGCGGATGTGGCCCATGTACAAC
TACACCGTGTTCAATGGATCGCTGGCCGAGCCGTATGTGAATCCCGGTGC
ACCAATACACATCATTTCGGGAGCTGCCGGCAATCACGAGGGCAGGGAGC
CATTCTTCAAGCGCATGCCTCCGTGGAGTGCCTTCCACAGCCAGGACTTT
GGGTATCTTCGACTGAAGGCCCACAACGGCACCCATCTACATTTCGAGCA
GGTGTCCGATGACAAGAAGGGCGAGGTCATCGATAGTTTCTGGGTGGTCA
AGGACAAGCATGGACCGTACCAGTCTGATCTCAACTCAAAAACTTTGTGA
TATTTTATGTCGTCATATACTAAAGTATTTTAAATTCGGGCACAAATTCG
AATGATTTATATTCGCAGCAATCGGACCAAGAAACTATCCTCCTTCTAAA
CATATATATTTTAATGAAATGTAATTACAGTTATACGCTCAAATAAAACA
ACTATGTATGAGTGGC

LD46373.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:36:31
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 10763486..10764366 1716..836 4405 100 Minus
chrX 22417052 chrX 10764447..10764790 835..492 1720 100 Minus
chrX 22417052 chrX 10768725..10769051 327..1 1545 98.2 Minus
chrX 22417052 chrX 10764852..10765021 495..326 850 100 Minus
chrX 22417052 chrX 10766553..10766790 834..597 320 75.6 Minus
chrX 22417052 chrX 10765800..10766456 1514..861 310 70.2 Minus
chrX 22417052 chrX 10762037..10762136 1513..1414 230 82 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:36:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG1637-RE 1362 CG1637-PE 1..1362 189..1550 6810 100 Plus
CG1637-RA 1362 CG1637-PA 1..1362 189..1550 6810 100 Plus
CG1637-RB 1377 CG1637-PB 1..141 189..329 705 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:36:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG1637-RE 1868 CG1637-RE 153..1868 1..1716 8580 100 Plus
CG1637-RA 1773 CG1637-RA 58..1773 1..1716 8580 100 Plus
CG1637-RB 2196 CG1637-RB 58..386 1..329 1645 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:36:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG1637-PE 453 CG1637-PE 20..453 246..1547 2411 100 Plus
CG1637-PA 453 CG1637-PA 20..453 246..1547 2411 100 Plus
CG1637-PB 458 CG1637-PB 20..458 246..1526 1577 65.8 Plus
CG1637-PD 459 CG1637-PD 20..459 246..1526 1571 65.5 Plus
CG1637-PC 450 CG1637-PC 20..448 246..1526 1522 63.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:36:25
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10872175..10873055 1716..836 4405 100 Minus
X 23542271 X 10873136..10873479 835..492 1720 100 Minus
X 23542271 X 10877415..10877741 327..1 1635 100 Minus
X 23542271 X 10873541..10873710 495..326 850 100 Minus
X 23542271 X 10875242..10875479 834..597 320 75.6 Minus
X 23542271 X 10874489..10875145 1514..861 310 70.2 Minus
X 23542271 X 10870726..10870825 1513..1414 230 82 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:03:57
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 10880273..10881153 1716..836 4405 100 Minus
X 23527363 X 10881234..10881577 835..492 1720 100 Minus
X 23527363 X 10885513..10885839 327..1 1635 100 Minus
X 23527363 X 10881639..10881808 495..326 850 100 Minus
X 23527363 X 10882587..10882727 1514..1374 225 77.3 Minus
X 23527363 X 10883443..10883510 731..664 220 88.2 Minus
X 23527363 X 10883158..10883243 946..861 220 83.7 Minus
X 23527363 X 10882996..10883089 1108..1015 200 80.8 Minus
X 23527363 X 10879728..10879773 734..689 185 93.4 Minus
X 23527363 X 10878864..10878923 1473..1414 180 86.6 Minus
X 23527363 X 10879303..10879410 1096..989 165 76.8 Minus
Blast to na_te.dros performed on 2014-11-27 16:36:26 has no hits.

LD46373.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:54:39 Download gff for LD46373.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 10768725..10769051 1..327 98   Minus
chrX 10764856..10765019 328..491 100 <- Minus
chrX 10764447..10764790 492..835 100 <- Minus
chrX 10763486..10764366 836..1716 100 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2010-12-10 09:34:29 Download gff for LD46373.complete
Subject Subject Range Query Range Percent Splice Strand
CG1637-RA 1..1362 189..1550 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:35:19 Download gff for LD46373.complete
Subject Subject Range Query Range Percent Splice Strand
CG1637-RA 1..1362 189..1550 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:54:39 Download gff for LD46373.complete
Subject Subject Range Query Range Percent Splice Strand
CG1637-RA 1..1362 189..1550 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2010-12-10 09:34:29 Download gff for LD46373.complete
Subject Subject Range Query Range Percent Splice Strand
CG1637-RA 67..1616 1..1550 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:35:19 Download gff for LD46373.complete
Subject Subject Range Query Range Percent Splice Strand
CG1637-RA 58..1773 1..1716 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:54:39 Download gff for LD46373.complete
Subject Subject Range Query Range Percent Splice Strand
CG1637-RA 58..1773 1..1716 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:54:39 Download gff for LD46373.complete
Subject Subject Range Query Range Percent Splice Strand
X 10877415..10877741 1..327 100   Minus
X 10873545..10873708 328..491 100 <- Minus
X 10873136..10873479 492..835 100 <- Minus
X 10872175..10873055 836..1716 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:35:19 Download gff for LD46373.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10771448..10771774 1..327 100   Minus
arm_X 10767578..10767741 328..491 100 <- Minus
arm_X 10767169..10767512 492..835 100 <- Minus
arm_X 10766208..10767088 836..1716 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:52:45 Download gff for LD46373.complete
Subject Subject Range Query Range Percent Splice Strand
X 10885513..10885839 1..327 100   Minus
X 10881643..10881806 328..491 100 <- Minus
X 10881234..10881577 492..835 100 <- Minus
X 10880273..10881153 836..1716 100 <- Minus

LD46373.pep Sequence

Translation from 188 to 1549

> LD46373.pep
MQRLQFALLASLLLLVLLLPGIRSTPIDQDVDIVHYQPEQVHLSFGETVL
DIVVTWNTRDNTNESICEFGIDGLHQRVKATQMPTKFVDGGAKKATQYIH
RVTLSHLKPNSTYLYHCGSELGWSATYWFRTRFDHADWSPSLAIYGDMGV
VNAASLPALQRETQSGQYDAIIHVGDFAYDMDWENGEVGDEFMRQVETIA
AYLPYMVCVGNHEEKYNFSHYINRFSMPGGSDNMFYSFDLGPVHFIGFST
EVYYFTKFGIKQIVMQYDWLERDLIEANKPENRKKRPWIITYGHRPMYCS
NDNGDDCANHETIVRKGLPMLDFFGLEPLFYQYGVDIELWAHEHCYERMW
PMYNYTVFNGSLAEPYVNPGAPIHIISGAAGNHEGREPFFKRMPPWSAFH
SQDFGYLRLKAHNGTHLHFEQVSDDKKGEVIDSFWVVKDKHGPYQSDLNS
KTL*

LD46373.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:56:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20209-PA 404 GF20209-PA 2..404 47..449 1986 88.9 Plus
Dana\GF20208-PA 461 GF20208-PA 1..459 1..444 1526 61.7 Plus
Dana\GF20210-PA 411 GF20210-PA 12..407 51..444 1329 60.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:56:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18893-PA 459 GG18893-PA 1..455 1..444 1522 65.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:56:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24659-PA 412 GH24659-PA 4..403 47..445 1881 83.5 Plus
Dgri\GH24658-PA 430 GH24658-PA 7..426 30..444 1528 66.5 Plus
Dgri\GH24660-PA 404 GH24660-PA 2..403 45..444 1387 61.9 Plus
Dgri\GH24661-PA 228 GH24661-PA 1..219 227..445 1087 86.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:56:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG1637-PE 453 CG1637-PE 1..453 1..453 2493 100 Plus
CG1637-PA 453 CG1637-PA 1..453 1..453 2493 100 Plus
CG1637-PB 458 CG1637-PB 1..458 1..446 1659 67.2 Plus
CG1637-PD 459 CG1637-PD 1..459 1..446 1653 66.9 Plus
CG1637-PC 450 CG1637-PC 1..448 1..446 1604 65.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:56:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16122-PA 402 GI16122-PA 2..400 47..444 1900 84.7 Plus
Dmoj\GI16121-PA 456 GI16121-PA 15..453 9..444 1555 64.9 Plus
Dmoj\GI16123-PA 407 GI16123-PA 1..406 41..444 1424 63.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:56:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14293-PA 404 GL14293-PA 3..404 47..448 1961 87.1 Plus
Dper\GL14292-PA 462 GL14292-PA 33..460 29..446 1524 65.3 Plus
Dper\GL14294-PA 417 GL14294-PA 17..415 48..444 1353 60.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:57:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22738-PA 404 GA22738-PA 3..404 47..448 1944 86.1 Plus
Dpse\GA14064-PA 462 GA14064-PA 33..460 29..446 1524 65.3 Plus
Dpse\GA22739-PA 417 GA22739-PA 17..415 48..444 1351 60.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:57:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11279-PA 449 GM11279-PA 1..447 1..446 1902 80.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:57:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16010-PA 460 GD16010-PA 1..458 1..446 1507 66.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:57:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16401-PA 405 GJ16401-PA 2..403 45..445 1884 83.6 Plus
Dvir\GJ16400-PA 457 GJ16400-PA 35..454 27..444 1550 66.8 Plus
Dvir\GJ16402-PA 414 GJ16402-PA 15..413 48..444 1382 62.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:57:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25790-PA 410 GK25790-PA 7..407 44..444 1856 81.8 Plus
Dwil\GK25789-PA 454 GK25789-PA 13..451 19..444 1459 61.5 Plus
Dwil\GK25791-PA 407 GK25791-PA 12..407 48..441 1345 61.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:57:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17337-PA 417 GE17337-PA 14..417 46..449 2160 96.3 Plus
Dyak\GE17336-PA 459 GE17336-PA 1..459 1..446 1528 65.2 Plus
Dyak\GE17338-PA 409 GE17338-PA 6..407 47..446 1364 61.4 Plus

LD46373.hyp Sequence

Translation from 188 to 1549

> LD46373.hyp
MQRLQFALLASLLLLVLLLPGIRSTPIDQDVDIVHYQPEQVHLSFGETVL
DIVVTWNTRDNTNESICEFGIDGLHQRVKATQMPTKFVDGGAKKATQYIH
RVTLSHLKPNSTYLYHCGSELGWSATYWFRTRFDHADWSPSLAIYGDMGV
VNAASLPALQRETQSGQYDAIIHVGDFAYDMDWENGEVGDEFMRQVETIA
AYLPYMVCVGNHEEKYNFSHYINRFSMPGGSDNMFYSFDLGPVHFIGFST
EVYYFTKFGIKQIVMQYDWLERDLIEANKPENRKKRPWIITYGHRPMYCS
NDNGDDCANHETIVRKGLPMLDFFGLEPLFYQYGVDIELWAHEHCYERMW
PMYNYTVFNGSLAEPYVNPGAPIHIISGAAGNHEGREPFFKRMPPWSAFH
SQDFGYLRLKAHNGTHLHFEQVSDDKKGEVIDSFWVVKDKHGPYQSDLNS
KTL*

LD46373.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:49:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG1637-PE 453 CG1637-PE 1..453 1..453 2493 100 Plus
CG1637-PA 453 CG1637-PA 1..453 1..453 2493 100 Plus
CG1637-PB 458 CG1637-PB 1..458 1..446 1659 67.2 Plus
CG1637-PD 459 CG1637-PD 1..459 1..446 1653 66.9 Plus
CG1637-PC 450 CG1637-PC 1..448 1..446 1604 65.4 Plus