Clone LD46584 Report

Search the DGRC for LD46584

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:465
Well:84
Vector:pOT2
Associated Gene/TranscriptalphaCOP-RA
Protein status:LD46584.pep: gold
Preliminary Size:4219
Sequenced Size:3969

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7961 2001-01-01 Release 2 assignment
CG7961 2002-01-03 Blastp of sequenced clone
CG7961 2003-01-01 Sim4 clustering to Release 3
alphaCop 2008-04-29 Release 5.5 accounting
alphaCop 2008-08-15 Release 5.9 accounting
alphaCop 2008-12-18 5.12 accounting

Clone Sequence Records

LD46584.complete Sequence

3969 bp (3969 high quality bases) assembled on 2002-01-03

GenBank Submission: AY075425

> LD46584.complete
TTCGACGATTGGCAAGTGCTCGAACCAGCAAAAAAAGGGCGCTTGACGGA
TAAGCCGACACCTAGAAGTGCATCCAATTTGAGACACCTACAGGCAGAAC
AGAAAAAGTGCCACCATGCTGACCAACTTCGAGTCGAAGTCGGCGAGGGT
GAAGGGCCTCTCCTTCCACCCTAAGCGCCCCTGGATCCTGGTCAGCTTGC
ACAGCGGCGTCATCCAGCTGTGGGACTACCGGATGCACACGCTCCTCGAG
AAGTTCGACGAGCACGACGGACCGGTGCGAGGCGTGGCCTTCCACCAGCA
GATGCCGCTCTTCGTCTCTGGCGGCGACGACTACAAGATCAAGGTGTGGA
ACTACAAGCAACGCCGATGCATTTTTACCCTCCTGGCCCATTTGGACTAT
GTGCGCACGGTGGCTTTCCACCACGAATACCCATGGATTCTGAGCGCCTC
CGACGATCAGACCATACGCATCTGGAACTGGCAGTCGCGCAACTGCATCT
GCGTGCTGACGGGCCACAACCACTATGTGATGTGCGCCCAGTTCCATCCC
ACGGAGGATCAGATCGTTTCTGCTTCACTCGATCAGACGGTGCGCGTGTG
GGACATTTCGGGGCTGCGTAAGAAGAACGTGGCTCCCGGGCCCGGTGGGC
TTGATGACCACCTAAAGGGTCATCCGGGTGCCACTGATCTGTTTGGCCAA
GCAGATGCCGTGGTCAAGCACGTGCTCGAGGGCCACGACCGTGGCGTCAA
CTGGGCCAGTTTCCATCCCACCCTGCCGCTGATTGTCTCCGGTGCCGATG
ATCGCCTTGTGAAGTTGTGGCGCATGAACGAGTACAAGGCTTGGGAGGTC
GACACCTGTCGCGGTCACTACAACAACGTGTCCAGCGTGTTGTTCCATCC
CAGGCAAGACCTGATTCTCTCCAACGGCGAAGATCGCAGTATTCGCGTCT
GGGACATGACCAAGCGCCAGTGCCTCTTTACATTCCGGCGGGACAACGAG
CGCTTCTGGATACTTACAGCGCATCCGACCCTGAATCTGTTTGCAGCTGG
CCACGATGGAGGTATGGTGGTCTTTAAACTGGAGCGAGAGCGTCCTGCAT
ATGCTGTCCACGGGAATATTCTCTACTACGTCAAGGAACGTTTCCTTCGC
AAACTGGACTTTACCACCACTAAGGACACTGTGGTTATGCAGCTTCGACC
AGGCAAGTCGCCGGTGTACAGCATGTCGTACAACCCAGCACTGAACGCCG
TGCTAATCTGCACGCGCACCAACAACCTGGAGAACAGCACCTACGATCTT
TGCCAAATCCCCAAGGACACCGAGAGCCAAAGTGAGTCGGACAGCAAGCG
AAGCTCTGGAATCACGGCCATCTGGGTGGCACGCAATCGGTTTGCAGTGC
TTGATCGCAACCAGCAGTTGGTGATCAAGAACTTCAAGAATGAGGTGACC
AAGAAGTTGCCAACTTTCTGCGAGGAGATCTTCTATGCCGGTACGGGAAT
GCTGCTCATTCGGGACCCTGAGTTTGTCACACTGTACGAAGTTCAGCGCC
TAGTCTCCGTTGGAAGCATTAAACTGGCCAAGTGCCGCTACGTGGTGTGG
TCTCCGGACATGTCCTTGGTCGCTCTACTCTGCAAGCACTCGGTTACAAT
CTGCGACCGAAGACTTCAGTACTTGTGCACCGTGCAGGAGAACTGCCGCG
TGAAGTCTGGCGCCTGGGACGAGTCTGGAGTGTTTATCTACACCACTAGC
AACCACATTAAGTACGCCATTACAAACGGGGACCACGGCATCATCCGTAC
GCTGGACCTACCCATTTATCTGACACGCGTCAAGGGCAACCAAGTGTTCT
GCTTGGACCGGGAGTGCCGCACCCGTGTGCTCCACATCGATCCTACGGAG
TACAAGTTTAAGCTTGCCCTGATTCAACGCAAGTACGATGAAGTACTGCA
TATGGTGAGAAATGCCCGCCTAGTGGGTCAGAGCATCATTGCTTACCTGC
AGCAAAAGGGTTATCCAGAGGTGGCACTGCATTTTGTCAAGGATGAGAAA
ACCCGATTTGGACTCGCTCTGGAGTGCGGTAACATCGAAATTGCTCTCGA
AGCAGCCAAGGCTCTCGATGACAAGGATTGCTGGGATCGCCTGGGACAGA
GTGCGCTGCTCCAAGGAAACCACCAGGTGGTAGAGATGTGCTACCAGCGG
ACCAAGAACTTTGACAAGCTTAGCTTCCTCTACCTGATCACCGGCAACTT
GGAGAAGCTCAAGAAGATGAACAAGATTGCCGAGATTCGCAAGGATGTTT
CCGCCCAGTACCAGGGTGCCCTCCTTCTCGGTGACGTCAAGGAGCGGGTA
AACATCCTCAAAAACTGCGGACAACTTTCGTTAGCTTATCTCACAGCCGC
TACTCATGGATTCGATGAGCTCACTGAGTCCCTGGGCGAATCGATAACCT
CGCAGGGTAACAGCCTTCCCGAGGTGAATCCCAATGCCCAGTTGTTGCAG
CCACCAGTGCCCATCCAGCAGCTTGAAACCAATTGGCCGTTGCTGTCCGT
GTCCAAGGGCTTCTTTGAAGGCGCCATGGTCACCAGGGCTGGCTCCAGTG
CCACTGCCCGACAGGCGCTGAACATCAACGCCGATGCTGCACTGTTGGAC
GAGCATAATGGTGGTGGAGATGGTTGGGGAGCGGATGCCGACTTGGGACT
AGATGAAGACGGAGATGACGAGATGCACGACGCGCTGAGCAACGATGGCG
ATGGTGGTGCGGGTGGAGAGGAGGGTGCCGGCTGGGATGTGGGCGATGAT
GACCTGGTTGTGCCCGAGGAACTGGCCTCCAAGATCAAGGCCTCAGCCCT
CGACAGCAACTACTATGCGGCTCCCAACAAAGGCTTGTCTCCTGCCCAAC
AATGGGCCAACAACTCGCCTCTGGTCCTGGACCATGTCAAGGCCGGATCA
TTCGAAACCGCCTTCCGTTTACTGCACGATCAGCTGGGAGTGGTCAATTT
CCAGCCATTCAAGACACTCTTCCTGCAGAACTACGCCTGCTCTCGAACGA
GCTACACGGCCAATCCGAATCTGCAATCCCTAAGTGGTTACCCACTTCGC
AACTACTCCGAGACAAACATCAAGCTGCAGCGTCCTGCGGTTGGCATTAA
ACTGAATGATTTGGTGGCACGCCTGCAAGCTGGGTACCAACTGACAACTT
CTGGAAAGTTCTCCGAGGCAGTAGAGAAGTTCCATTCCATCTTGATTAGC
ATCCCACTGCTGGTAGTGGACACGAAGCTAGATGCGGCGGAGGCCCAGCA
ACTCTTAAGGATCTGCGCTGAGTATATCGTTGGCCTGAAGATGGAGACTG
TGCGCAAGGGCATGCCCAAGTCGACGCTTGAGGAGCAAAAGCGTCTGTGC
GAGATGGCCGCCTACTTCACGCACTGCAAGCTTCAGCCCGTGCACCAAAT
CCTCACCCTGCGTACCGCCCTCAATATGTTCTTCAAGCTGAAGAACTACA
AGACGGCCGCCTCATTTGCCCGTCGTCTCCTGGAACTGGCGCCACGACCG
GACGTTGCCCAGCAGGTGCGCAAGATCCTGCAGGCCTGCGAGGTAAATCC
CGTGGACGAGCATCAGCTGCAGTACGAGGAGTTTAATCCGTTCACAATCT
GCGGCATCAGCTGGAAGCCACTGTATAGGGGTAAACCCGAAGTGACCTGT
CCCTTCTGCTCCTCCTCTTTCGACCCTCAGTTCAAGGGCAATCTCTGCAC
AGTTTGCGAAGTGAGCCAGATCGGCAAGGATAGCATTGGCCTGCGCATTT
CAAACCTGCAATTCCGCTAGGACGGACTAGCTTGTCGCTTTTAATATAAA
TGTTTCCAACACGCCGAGCGAGACCCCATAGTTTAGTTTTACACGATCCT
TGCTTATTATGTATAAAGTTCAGTATCTGTATATTATAATGCTATAAAAT
CAAAAAAAAAAAAAAAAAA

LD46584.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:34:01
Subject Length Description Subject Range Query Range Score Percent Strand
alphaCop-RB 4151 alphaCop-RB 114..4067 1..3954 19770 100 Plus
alphaCop-RA 4111 alphaCop-RA 162..4105 11..3954 19720 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 14:14:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1640662..1643553 3951..1060 14295 99.6 Minus
chr3L 24539361 chr3L 1643606..1644657 1063..11 5170 99.6 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:14:52
Subject Length Description Subject Range Query Range Score Percent Strand
alphaCOP-RA 3705 CG7961-PA 1..3705 116..3820 18525 100 Plus
alphaCOP-RB 3705 CG7961-PB 1..3705 116..3820 18525 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:43:08 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:14:51
Subject Length Description Subject Range Query Range Score Percent Strand
alphaCOP-RB 3970 CG7961-RB 20..3970 1..3951 19755 100 Plus
alphaCOP-RA 4078 CG7961-RA 138..4078 11..3951 19705 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 14:14:56
Subject Length Description Subject Range Query Range Score Percent Strand
alphaCOP-PA 1234 CG7961-PA 1..1234 116..3817 5966 100 Plus
alphaCOP-PB 1234 CG7961-PB 1..1234 116..3817 5966 100 Plus
beta'COP-PA 914 CG6699-PA 13..792 134..2473 623 25.6 Plus
Lis-1-PG 411 CG8440-PG 109..376 143..982 297 27.4 Plus
Lis-1-PF 411 CG8440-PF 109..376 143..982 297 27.4 Plus
Lis-1-PG 411 CG8440-PG 306..409 293..604 235 38.5 Plus
Lis-1-PG 411 CG8440-PG 306..408 167..475 203 35 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:14:49
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1641063..1643957 3954..1060 14475 100 Minus
3L 28110227 3L 1644010..1645062 1063..11 5265 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:02:00
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1641063..1643957 3954..1060 14475 100 Minus
3L 28103327 3L 1644010..1645062 1063..11 5265 100 Minus
Blast to na_te.dros performed on 2014-11-27 14:14:50 has no hits.

LD46584.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:35:16 Download gff for LD46584.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1643608..1644660 5..1061 99   Minus
chr3L 1640662..1643551 1062..3951 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:30:18 Download gff for LD46584.complete
Subject Subject Range Query Range Percent Splice Strand
alphaCop-RA 1..3705 116..3820 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:56:12 Download gff for LD46584.complete
Subject Subject Range Query Range Percent Splice Strand
alphaCop-RA 1..3705 116..3820 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:11:15 Download gff for LD46584.complete
Subject Subject Range Query Range Percent Splice Strand
alphaCop-RB 1..3705 116..3820 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:21:02 Download gff for LD46584.complete
Subject Subject Range Query Range Percent Splice Strand
alphaCop-RA 1..3705 116..3820 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:35:16 Download gff for LD46584.complete
Subject Subject Range Query Range Percent Splice Strand
alphaCOP-RB 1..3705 116..3820 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:20:17 Download gff for LD46584.complete
Subject Subject Range Query Range Percent Splice Strand
alphaCop-RB 34..3984 1..3951 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:56:12 Download gff for LD46584.complete
Subject Subject Range Query Range Percent Splice Strand
alphaCop-RB 56..4006 1..3951 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:11:15 Download gff for LD46584.complete
Subject Subject Range Query Range Percent Splice Strand
alphaCop-RB 20..3970 1..3951 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:21:03 Download gff for LD46584.complete
Subject Subject Range Query Range Percent Splice Strand
alphaCop-RB 34..3984 1..3951 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:35:16 Download gff for LD46584.complete
Subject Subject Range Query Range Percent Splice Strand
alphaCOP-RB 20..3970 1..3951 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:35:16 Download gff for LD46584.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1644012..1645065 5..1061 99   Minus
3L 1641066..1643955 1062..3951 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:11:15 Download gff for LD46584.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1644012..1645065 5..1061 99   Minus
arm_3L 1641066..1643955 1062..3951 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:55:43 Download gff for LD46584.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1644012..1645065 5..1061 99   Minus
3L 1641066..1643955 1062..3951 100 <- Minus

LD46584.pep Sequence

Translation from 115 to 3819

> LD46584.pep
MLTNFESKSARVKGLSFHPKRPWILVSLHSGVIQLWDYRMHTLLEKFDEH
DGPVRGVAFHQQMPLFVSGGDDYKIKVWNYKQRRCIFTLLAHLDYVRTVA
FHHEYPWILSASDDQTIRIWNWQSRNCICVLTGHNHYVMCAQFHPTEDQI
VSASLDQTVRVWDISGLRKKNVAPGPGGLDDHLKGHPGATDLFGQADAVV
KHVLEGHDRGVNWASFHPTLPLIVSGADDRLVKLWRMNEYKAWEVDTCRG
HYNNVSSVLFHPRQDLILSNGEDRSIRVWDMTKRQCLFTFRRDNERFWIL
TAHPTLNLFAAGHDGGMVVFKLERERPAYAVHGNILYYVKERFLRKLDFT
TTKDTVVMQLRPGKSPVYSMSYNPALNAVLICTRTNNLENSTYDLCQIPK
DTESQSESDSKRSSGITAIWVARNRFAVLDRNQQLVIKNFKNEVTKKLPT
FCEEIFYAGTGMLLIRDPEFVTLYEVQRLVSVGSIKLAKCRYVVWSPDMS
LVALLCKHSVTICDRRLQYLCTVQENCRVKSGAWDESGVFIYTTSNHIKY
AITNGDHGIIRTLDLPIYLTRVKGNQVFCLDRECRTRVLHIDPTEYKFKL
ALIQRKYDEVLHMVRNARLVGQSIIAYLQQKGYPEVALHFVKDEKTRFGL
ALECGNIEIALEAAKALDDKDCWDRLGQSALLQGNHQVVEMCYQRTKNFD
KLSFLYLITGNLEKLKKMNKIAEIRKDVSAQYQGALLLGDVKERVNILKN
CGQLSLAYLTAATHGFDELTESLGESITSQGNSLPEVNPNAQLLQPPVPI
QQLETNWPLLSVSKGFFEGAMVTRAGSSATARQALNINADAALLDEHNGG
GDGWGADADLGLDEDGDDEMHDALSNDGDGGAGGEEGAGWDVGDDDLVVP
EELASKIKASALDSNYYAAPNKGLSPAQQWANNSPLVLDHVKAGSFETAF
RLLHDQLGVVNFQPFKTLFLQNYACSRTSYTANPNLQSLSGYPLRNYSET
NIKLQRPAVGIKLNDLVARLQAGYQLTTSGKFSEAVEKFHSILISIPLLV
VDTKLDAAEAQQLLRICAEYIVGLKMETVRKGMPKSTLEEQKRLCEMAAY
FTHCKLQPVHQILTLRTALNMFFKLKNYKTAASFARRLLELAPRPDVAQQ
VRKILQACEVNPVDEHQLQYEEFNPFTICGISWKPLYRGKPEVTCPFCSS
SFDPQFKGNLCTVCEVSQIGKDSIGLRISNLQFR*

LD46584.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 23:17:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24978-PA 1233 GF24978-PA 1..1233 1..1234 6404 97.6 Plus
Dana\GF23142-PA 917 GF23142-PA 13..792 7..786 686 26 Plus
Dana\GF11864-PA 411 GF11864-PA 109..377 10..290 281 26.6 Plus
Dana\GF10412-PA 403 GF10412-PA 13..297 4..279 250 25.1 Plus
Dana\GF11864-PA 411 GF11864-PA 306..409 60..163 242 39.4 Plus
Dana\GF22217-PA 361 GF22217-PA 75..346 12..312 241 23.4 Plus
Dana\GF11864-PA 411 GF11864-PA 306..408 18..120 205 35 Plus
Dana\GF10412-PA 403 GF10412-PA 56..311 5..247 198 21.9 Plus
Dana\GF11864-PA 411 GF11864-PA 102..274 87..291 176 25.9 Plus
Dana\GF10412-PA 403 GF10412-PA 14..276 131..379 158 23.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 23:17:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14579-PA 1234 GG14579-PA 1..1234 1..1234 6655 99.5 Plus
Dere\GG23847-PA 913 GG23847-PA 13..792 7..786 689 26.5 Plus
Dere\GG13777-PA 390 GG13777-PA 13..297 4..279 298 27.9 Plus
Dere\GG20577-PA 411 GG20577-PA 109..377 10..290 284 27.3 Plus
Dere\GG12938-PA 361 GG12938-PA 75..345 12..311 242 23.4 Plus
Dere\GG20577-PA 411 GG20577-PA 306..409 60..163 236 38.5 Plus
Dere\GG20577-PA 411 GG20577-PA 306..409 18..121 204 34.6 Plus
Dere\GG20577-PA 411 GG20577-PA 102..274 87..291 182 25.9 Plus
Dere\GG13777-PA 390 GG13777-PA 14..276 131..379 166 23.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 23:17:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15519-PA 1238 GH15519-PA 1..1238 1..1234 6157 93.4 Plus
Dgri\GH13464-PA 919 GH13464-PA 13..763 7..764 697 26.5 Plus
Dgri\GH11782-PA 306 GH11782-PA 13..303 9..328 477 32.9 Plus
Dgri\GH13463-PA 306 GH13463-PA 13..303 9..328 476 33.7 Plus
Dgri\GH25102-PA 306 GH25102-PA 13..303 9..328 475 32.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:17:26
Subject Length Description Subject Range Query Range Score Percent Strand
alphaCOP-PA 1234 CG7961-PA 1..1234 1..1234 6525 100 Plus
alphaCOP-PB 1234 CG7961-PB 1..1234 1..1234 6525 100 Plus
beta'COP-PA 914 CG6699-PA 13..792 7..786 669 25.9 Plus
Lis-1-PG 411 CG8440-PG 109..376 10..289 297 27.4 Plus
Lis-1-PF 411 CG8440-PF 109..376 10..289 297 27.4 Plus
Lis-1-PG 411 CG8440-PG 306..409 60..163 235 38.5 Plus
Lis-1-PG 411 CG8440-PG 306..408 18..120 203 35 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 23:17:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16798-PA 1236 GI16798-PA 1..1236 1..1234 6238 93.5 Plus
Dmoj\GI17217-PA 924 GI17217-PA 13..792 7..786 697 26.6 Plus
Dmoj\GI20573-PA 411 GI20573-PA 109..377 10..290 277 26.6 Plus
Dmoj\GI11850-PA 402 GI11850-PA 10..294 4..279 249 27.2 Plus
Dmoj\GI21774-PA 358 GI21774-PA 72..343 12..312 241 23.4 Plus
Dmoj\GI20573-PA 411 GI20573-PA 306..409 60..163 231 37.5 Plus
Dmoj\GI20573-PA 411 GI20573-PA 306..408 18..120 201 34 Plus
Dmoj\GI11850-PA 402 GI11850-PA 53..307 5..246 186 22.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 23:17:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20730-PA 1235 GL20730-PA 1..1235 1..1234 6229 95 Plus
Dper\GL26050-PA 875 GL26050-PA 13..709 7..710 648 26.4 Plus
Dper\GL10701-PA 411 GL10701-PA 109..377 10..290 278 26.6 Plus
Dper\GL15696-PA 413 GL15696-PA 13..297 4..279 274 25.4 Plus
Dper\GL25365-PA 413 GL25365-PA 13..297 4..279 268 25.1 Plus
Dper\GL10701-PA 411 GL10701-PA 306..409 60..163 235 38.5 Plus
Dper\GL10701-PA 411 GL10701-PA 306..408 18..120 205 35 Plus
Dper\GL10701-PA 411 GL10701-PA 104..252 131..311 171 29.1 Plus
Dper\GL15696-PA 413 GL15696-PA 14..276 131..379 164 23.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 23:17:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20724-PA 1235 GA20724-PA 1..1235 1..1234 6233 95.1 Plus
Dpse\GA19792-PA 915 GA19792-PA 13..792 7..786 686 25.9 Plus
Dpse\GA21079-PA 411 GA21079-PA 109..377 10..290 278 26.6 Plus
Dpse\GA10144-PA 413 GA10144-PA 13..297 4..279 272 25.1 Plus
Dpse\GA26333-PB 299 GA26333-PB 13..297 4..279 262 25.3 Plus
Dpse\GA21079-PA 411 GA21079-PA 306..409 60..163 235 38.5 Plus
Dpse\GA21079-PA 411 GA21079-PA 306..408 18..120 205 35 Plus
Dpse\GA10144-PA 413 GA10144-PA 56..300 5..238 203 21.2 Plus
Dpse\GA21079-PA 411 GA21079-PA 104..252 131..311 171 29.1 Plus
Dpse\GA10144-PA 413 GA10144-PA 14..276 131..379 165 23.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 23:17:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14193-PA 1234 GM14193-PA 1..1234 1..1234 6657 99.5 Plus
Dsec\GM10466-PA 914 GM10466-PA 13..792 7..786 688 26.6 Plus
Dsec\GM24599-PA 389 GM24599-PA 13..297 4..279 295 27.6 Plus
Dsec\GM21668-PA 411 GM21668-PA 109..377 10..290 285 27.3 Plus
Dsec\GM21820-PA 353 GM21820-PA 49..345 41..329 269 27 Plus
Dsec\GM21668-PA 411 GM21668-PA 306..409 60..163 236 38.5 Plus
Dsec\GM21668-PA 411 GM21668-PA 306..409 18..121 204 34.6 Plus
Dsec\GM21668-PA 411 GM21668-PA 102..274 87..291 183 25.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 23:17:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23895-PA 913 GD23895-PA 13..792 7..786 690 26.6 Plus
Dsim\GD12669-PA 389 GD12669-PA 13..297 4..279 295 28 Plus
Dsim\GD11168-PA 411 GD11168-PA 109..377 10..290 285 27.3 Plus
Dsim\GD11312-PA 353 GD11312-PA 49..345 41..329 266 26.6 Plus
Dsim\GD16610-PA 361 GD16610-PA 75..345 12..311 242 23.4 Plus
Dsim\GD11168-PA 411 GD11168-PA 306..409 60..163 236 38.5 Plus
Dsim\GD11168-PA 411 GD11168-PA 306..409 18..121 204 34.6 Plus
Dsim\GD11168-PA 411 GD11168-PA 102..274 87..291 183 25.9 Plus
Dsim\GD11312-PA 353 GD11312-PA 183..351 12..176 174 26.9 Plus
Dsim\GD11312-PA 353 GD11312-PA 146..297 17..164 166 27.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 23:17:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12542-PA 1237 GJ12542-PA 1..1237 1..1234 6147 93.1 Plus
Dvir\GJ17974-PA 926 GJ17974-PA 13..792 7..786 686 26.9 Plus
Dvir\GJ21422-PA 411 GJ21422-PA 109..377 10..290 281 26.6 Plus
Dvir\GJ13548-PA 405 GJ13548-PA 10..295 4..280 258 24.7 Plus
Dvir\GJ16947-PA 358 GJ16947-PA 72..343 12..312 242 23.4 Plus
Dvir\GJ21422-PA 411 GJ21422-PA 306..409 60..163 238 38.5 Plus
Dvir\GJ21422-PA 411 GJ21422-PA 306..408 18..120 206 35 Plus
Dvir\GJ13548-PA 405 GJ13548-PA 53..297 5..238 200 23.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 23:17:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23658-PA 1234 GK23658-PA 1..1234 1..1234 6262 95.5 Plus
Dwil\GK14844-PA 922 GK14844-PA 13..763 7..764 689 26.5 Plus
Dwil\GK12739-PA 309 GK12739-PA 15..309 9..325 401 31.4 Plus
Dwil\GK22131-PA 409 GK22131-PA 107..375 10..290 280 26.9 Plus
Dwil\GK10412-PA 414 GK10412-PA 13..297 4..279 262 24 Plus
Dwil\GK12739-PA 309 GK12739-PA 52..304 1..268 237 25 Plus
Dwil\GK22131-PA 409 GK22131-PA 304..407 60..163 235 38.5 Plus
Dwil\GK22131-PA 409 GK22131-PA 304..406 18..120 205 35 Plus
Dwil\GK22131-PA 409 GK22131-PA 102..249 131..310 180 30.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 23:17:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20939-PA 1234 GE20939-PA 1..1234 1..1234 6662 99.4 Plus
Dyak\GE18651-PA 914 GE18651-PA 13..792 7..786 688 26.5 Plus
Dyak\GE11762-PA 411 GE11762-PA 109..377 10..290 284 27.3 Plus
Dyak\GE20071-PA 391 GE20071-PA 13..297 4..279 283 27.6 Plus
Dyak\GE11895-PA 343 GE11895-PA 54..328 50..312 256 27 Plus
Dyak\GE11762-PA 411 GE11762-PA 306..409 60..163 236 38.5 Plus
Dyak\GE11762-PA 411 GE11762-PA 306..409 18..121 204 34.6 Plus
Dyak\GE20071-PA 391 GE20071-PA 56..300 5..238 202 24.2 Plus
Dyak\GE11762-PA 411 GE11762-PA 102..274 87..291 182 25.9 Plus
Dyak\GE20071-PA 391 GE20071-PA 14..276 131..379 170 23.9 Plus

LD46584.hyp Sequence

Translation from 115 to 3819

> LD46584.hyp
MLTNFESKSARVKGLSFHPKRPWILVSLHSGVIQLWDYRMHTLLEKFDEH
DGPVRGVAFHQQMPLFVSGGDDYKIKVWNYKQRRCIFTLLAHLDYVRTVA
FHHEYPWILSASDDQTIRIWNWQSRNCICVLTGHNHYVMCAQFHPTEDQI
VSASLDQTVRVWDISGLRKKNVAPGPGGLDDHLKGHPGATDLFGQADAVV
KHVLEGHDRGVNWASFHPTLPLIVSGADDRLVKLWRMNEYKAWEVDTCRG
HYNNVSSVLFHPRQDLILSNGEDRSIRVWDMTKRQCLFTFRRDNERFWIL
TAHPTLNLFAAGHDGGMVVFKLERERPAYAVHGNILYYVKERFLRKLDFT
TTKDTVVMQLRPGKSPVYSMSYNPALNAVLICTRTNNLENSTYDLCQIPK
DTESQSESDSKRSSGITAIWVARNRFAVLDRNQQLVIKNFKNEVTKKLPT
FCEEIFYAGTGMLLIRDPEFVTLYEVQRLVSVGSIKLAKCRYVVWSPDMS
LVALLCKHSVTICDRRLQYLCTVQENCRVKSGAWDESGVFIYTTSNHIKY
AITNGDHGIIRTLDLPIYLTRVKGNQVFCLDRECRTRVLHIDPTEYKFKL
ALIQRKYDEVLHMVRNARLVGQSIIAYLQQKGYPEVALHFVKDEKTRFGL
ALECGNIEIALEAAKALDDKDCWDRLGQSALLQGNHQVVEMCYQRTKNFD
KLSFLYLITGNLEKLKKMNKIAEIRKDVSAQYQGALLLGDVKERVNILKN
CGQLSLAYLTAATHGFDELTESLGESITSQGNSLPEVNPNAQLLQPPVPI
QQLETNWPLLSVSKGFFEGAMVTRAGSSATARQALNINADAALLDEHNGG
GDGWGADADLGLDEDGDDEMHDALSNDGDGGAGGEEGAGWDVGDDDLVVP
EELASKIKASALDSNYYAAPNKGLSPAQQWANNSPLVLDHVKAGSFETAF
RLLHDQLGVVNFQPFKTLFLQNYACSRTSYTANPNLQSLSGYPLRNYSET
NIKLQRPAVGIKLNDLVARLQAGYQLTTSGKFSEAVEKFHSILISIPLLV
VDTKLDAAEAQQLLRICAEYIVGLKMETVRKGMPKSTLEEQKRLCEMAAY
FTHCKLQPVHQILTLRTALNMFFKLKNYKTAASFARRLLELAPRPDVAQQ
VRKILQACEVNPVDEHQLQYEEFNPFTICGISWKPLYRGKPEVTCPFCSS
SFDPQFKGNLCTVCEVSQIGKDSIGLRISNLQFR*

LD46584.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:38:52
Subject Length Description Subject Range Query Range Score Percent Strand
alphaCOP-PA 1234 CG7961-PA 1..1234 1..1234 6525 100 Plus
alphaCOP-PB 1234 CG7961-PB 1..1234 1..1234 6525 100 Plus
beta'COP-PA 914 CG6699-PA 13..792 7..786 669 25.9 Plus
Lis-1-PG 411 CG8440-PG 109..376 10..289 297 27.4 Plus
Lis-1-PF 411 CG8440-PF 109..376 10..289 297 27.4 Plus
Lis-1-PG 411 CG8440-PG 306..409 60..163 235 38.5 Plus
Lis-1-PG 411 CG8440-PG 306..408 18..120 203 35 Plus