Clone LP01337 Report

Search the DGRC for LP01337

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:13
Well:37
Vector:pOT2
Associated Gene/TranscriptCG11670-RD
Protein status:LP01337.pep: gold
Preliminary Size:1407
Sequenced Size:1338

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11670 2002-01-01 Sim4 clustering to Release 2
CG11670 2003-01-01 Sim4 clustering to Release 3
CG11670 2008-04-29 Release 5.5 accounting
CG11670 2008-04-29 Picked prior to 5.5
CG11670 2008-08-15 Release 5.9 accounting
CG11670 2008-12-18 5.12 accounting

Clone Sequence Records

LP01337.complete Sequence

1338 bp assembled on 2007-09-19

GenBank Submission: BT030998

> LP01337.complete
GTCAATCGAGCAAGACCTCTACAGATGGCGGATTGGAAGAGACCTTTGGA
GACCTGCATCGCACTCTGTGTGCTCCTGTGCGTATTTCACGTGAACGGAC
AGTGGGAGTTTCCCGCCCAGTATCCGGAACCGTATCGAAATCCGAATCCG
AATCCAGTGCCGGATCCAACCAGACCGCCGCCGCCACCACCTTCTCCGCC
ATGTGGAAGACCACCGCCTGGATCTCCGCCACCGGGCCCGCCTCCACCTG
GTCCTCCACCTGGTTGCCCCGGAGGTCCAGGAGGTCCGCTGCAGCATCGG
CAATGGGACAATGGCCCCAGGCAGTGGCAACCACGTCGTCCGCCACCAAA
TCACCATCGCAACTTCCACAACATCTTCCTGAACACCGAAAGCAAAGTGG
ACGGGGAGAACTACAACAAGACCGCGGAGACGGAGGACTTGCACGACGAC
TTCAATGGCCGATCCATTGTGGCACCTGGACAGTACCCGCACATGGCCGC
TCTGGGATTCCGGAACGAGAACCACGAGATCGACTACAAATGTGGTGGAA
GCCTCATCAGCGAAGAGTTCGTGCTCACAGCTGCTCATTGCCTGACTACT
CATGGCACCTCGCCCGACATCGTAAAAATCGGAGACATTAAGCTCAAGGA
ATGGGAGCTCAACGTGGCGCCCCAAAGACGACGTGTTGCCCAGATCTATC
TGCATCCACTGTACAATGCGAGTCTTAACTACCATGACATCGGGCTCATC
CAGCTGAATCGACCGGTGGAATACACCTGGTTCGTGAGGCCAGTTCGCCT
GTGGCCCATGAACGACATACCATACGGCAAGCTGCACACCATGGGCTATG
GCTCGACGGGATTCGCCCAGCCGCAGACGAACATACTCACGGAACTGGAT
CTCTCGGTGGTGCCCATTGAGCAGTGTAACTCCAGTCTGCCAGCCGACGA
AGGTTCTCCCCACGGATTACTCACAAGTCAGATATGCGCCCATGACTATG
AGAAAAATCGCGATACTTGCCAGGGCGATTCTGGAGGACCGCTTCAACTG
AACTTGGAACGTCGGCGTCGAAGGCACACAAGTCGTAAACACTATCGCTA
CTACCTGGTGGGCATCACATCGTATGGAGCATATTGTCGCAGTGAACTTC
CAGGTGTTTATACGCGTGTTTCATCCTATATCGATTGGATAGCATCCATA
GTGTGGCCTAATTATTATAGCGAATTTACTAATCAATAAAAAGCAGTCTA
TAAAATGTCACAAACAAAAAGTTGTAAAAAAAAGAAAATTTTAATTTTAA
TTAAAGCATAGCAAAAAGTAAAAAAAAAAAAAAAAAAA

LP01337.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:35:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG11670-RD 1326 CG11670-RD 7..1326 1..1320 6600 100 Plus
CG11670-RE 1470 CG11670-RE 253..1282 172..1201 5150 100 Plus
CG11670-RE 1470 CG11670-RE 1..173 1..173 865 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 00:12:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8868479..8868898 605..1024 2070 99.5 Plus
chr3R 27901430 chr3R 8867549..8867873 172..496 1550 98.5 Plus
chr3R 27901430 chr3R 8867297..8867469 1..173 820 98.3 Plus
chr3R 27901430 chr3R 8869137..8869308 1151..1319 750 97.1 Plus
chr3R 27901430 chr3R 8868949..8869082 1022..1155 670 100 Plus
chr3R 27901430 chr3R 8868113..8868223 495..605 555 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:12:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG11670-RD 1215 CG11670-PD 1..1215 25..1239 6075 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:45:57 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:12:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG11670-RD 1337 CG11670-RD 19..1337 1..1319 6595 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 00:12:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG11670-PD 404 CG11670-PD 1..404 25..1236 1721 100 Plus
CG14642-PC 392 CG14642-PC 131..391 415..1206 709 52.5 Plus
CG14642-PB 392 CG14642-PB 131..391 415..1206 709 52.5 Plus
snk-PB 435 CG7996-PB 195..435 478..1215 448 38.6 Plus
snk-PA 435 CG7996-PA 195..435 478..1215 448 38.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:12:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13043250..13043669 605..1024 2100 100 Plus
3R 32079331 3R 13042320..13042644 172..496 1625 100 Plus
3R 32079331 3R 13042068..13042240 1..173 865 100 Plus
3R 32079331 3R 13043918..13044087 1151..1320 850 100 Plus
3R 32079331 3R 13043720..13043853 1022..1155 670 100 Plus
3R 32079331 3R 13042884..13042994 495..605 555 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:32:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12784081..12784500 605..1024 2100 100 Plus
3R 31820162 3R 12783151..12783475 172..496 1625 100 Plus
3R 31820162 3R 12782899..12783071 1..173 865 100 Plus
3R 31820162 3R 12784749..12784918 1151..1320 850 100 Plus
3R 31820162 3R 12784551..12784684 1022..1155 670 100 Plus
3R 31820162 3R 12783715..12783825 495..605 555 100 Plus
Blast to na_te.dros performed on 2014-11-27 00:12:31 has no hits.

LP01337.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:42:55 Download gff for LP01337.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8868951..8869080 1024..1153 100 -> Plus
chr3R 8868480..8868897 606..1023 99 -> Plus
chr3R 8868114..8868223 496..605 100 -> Plus
chr3R 8867551..8867872 174..495 98 -> Plus
chr3R 8867297..8867469 1..173 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:32:56 Download gff for LP01337.complete
Subject Subject Range Query Range Percent Splice Strand
CG11670-RD 1..1215 25..1239 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:05:13 Download gff for LP01337.complete
Subject Subject Range Query Range Percent Splice Strand
CG11670-RD 1..1215 25..1239 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:51:39 Download gff for LP01337.complete
Subject Subject Range Query Range Percent Splice Strand
CG11670-RD 1..1215 25..1239 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:51:32 Download gff for LP01337.complete
Subject Subject Range Query Range Percent Splice Strand
CG11670-RC 1..1177 25..1201 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:42:55 Download gff for LP01337.complete
Subject Subject Range Query Range Percent Splice Strand
CG11670-RD 1..1215 25..1239 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:58:10 Download gff for LP01337.complete
Subject Subject Range Query Range Percent Splice Strand
CG11670-RD 1..1319 1..1319 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:05:13 Download gff for LP01337.complete
Subject Subject Range Query Range Percent Splice Strand
CG11670-RD 1..1319 1..1319 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:51:39 Download gff for LP01337.complete
Subject Subject Range Query Range Percent Splice Strand
CG11670-RD 19..1337 1..1319 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:51:32 Download gff for LP01337.complete
Subject Subject Range Query Range Percent Splice Strand
CG11670-RC 1..1201 1..1201 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:42:55 Download gff for LP01337.complete
Subject Subject Range Query Range Percent Splice Strand
CG11670-RD 19..1337 1..1319 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:42:55 Download gff for LP01337.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13043921..13044086 1154..1319 100   Plus
3R 13043722..13043851 1024..1153 100 -> Plus
3R 13043251..13043668 606..1023 100 -> Plus
3R 13042885..13042994 496..605 100 -> Plus
3R 13042322..13042643 174..495 100 -> Plus
3R 13042068..13042240 1..173 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:51:39 Download gff for LP01337.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8869643..8869808 1154..1319 100   Plus
arm_3R 8869444..8869573 1024..1153 100 -> Plus
arm_3R 8868973..8869390 606..1023 100 -> Plus
arm_3R 8868607..8868716 496..605 100 -> Plus
arm_3R 8868044..8868365 174..495 100 -> Plus
arm_3R 8867790..8867962 1..173 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:57:22 Download gff for LP01337.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12784752..12784917 1154..1319 100   Plus
3R 12784553..12784682 1024..1153 100 -> Plus
3R 12784082..12784499 606..1023 100 -> Plus
3R 12783716..12783825 496..605 100 -> Plus
3R 12783153..12783474 174..495 100 -> Plus
3R 12782899..12783071 1..173 100 -> Plus

LP01337.pep Sequence

Translation from 0 to 1238

> LP01337.pep
VNRARPLQMADWKRPLETCIALCVLLCVFHVNGQWEFPAQYPEPYRNPNP
NPVPDPTRPPPPPPSPPCGRPPPGSPPPGPPPPGPPPGCPGGPGGPLQHR
QWDNGPRQWQPRRPPPNHHRNFHNIFLNTESKVDGENYNKTAETEDLHDD
FNGRSIVAPGQYPHMAALGFRNENHEIDYKCGGSLISEEFVLTAAHCLTT
HGTSPDIVKIGDIKLKEWELNVAPQRRRVAQIYLHPLYNASLNYHDIGLI
QLNRPVEYTWFVRPVRLWPMNDIPYGKLHTMGYGSTGFAQPQTNILTELD
LSVVPIEQCNSSLPADEGSPHGLLTSQICAHDYEKNRDTCQGDSGGPLQL
NLERRRRRHTSRKHYRYYLVGITSYGAYCRSELPGVYTRVSSYIDWIASI
VWPNYYSEFTNQ*

LP01337.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 20:17:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17570-PA 402 GF17570-PA 98..402 108..412 1389 89.2 Plus
Dana\GF16825-PA 391 GF16825-PA 142..389 153..404 742 55.6 Plus
Dana\GF21733-PA 404 GF21733-PA 154..381 161..404 432 40.7 Plus
Dana\GF21731-PA 421 GF21731-PA 163..392 161..406 429 40.7 Plus
Dana\GF17410-PA 438 GF17410-PA 153..438 131..405 424 34.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 20:17:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19401-PA 410 GG19401-PA 100..410 102..412 1479 93.2 Plus
Dere\GG11752-PA 384 GG11752-PA 119..383 113..402 632 47.9 Plus
Dere\GG17080-PA 435 GG17080-PA 144..435 124..405 439 34.8 Plus
Dere\GG19037-PA 399 GG19037-PA 113..366 137..403 422 38.5 Plus
Dere\GG18120-PA 670 GG18120-PA 424..666 157..403 400 35.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 20:17:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21866-PA 388 GH21866-PA 101..383 104..402 720 48.5 Plus
Dgri\GH19195-PA 422 GH19195-PA 188..422 162..405 440 37.1 Plus
Dgri\GH24792-PA 402 GH24792-PA 151..376 161..404 408 39.6 Plus
Dgri\GH12343-PA 758 GH12343-PA 509..755 153..404 363 34.8 Plus
Dgri\GH18678-PA 325 GH18678-PA 80..317 153..397 315 32.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 20:17:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG11670-PD 404 CG11670-PD 1..404 9..412 2296 100 Plus
CG14642-PC 392 CG14642-PC 76..391 53..402 777 47 Plus
CG14642-PB 392 CG14642-PB 76..391 53..402 777 47 Plus
snk-PB 435 CG7996-PB 195..435 160..405 452 38.7 Plus
snk-PA 435 CG7996-PA 195..435 160..405 452 38.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 20:17:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21934-PA 382 GI21934-PA 36..377 28..402 679 42.5 Plus
Dmoj\GI15228-PA 382 GI15228-PA 136..366 161..404 460 42.4 Plus
Dmoj\GI15354-PA 359 GI15354-PA 124..349 161..399 428 41.7 Plus
Dmoj\GI24229-PA 405 GI24229-PA 171..405 162..405 426 36.3 Plus
Dmoj\GI15591-PA 482 GI15591-PA 234..481 157..406 386 37.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 20:17:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24386-PA 487 GL24386-PA 123..397 111..384 1213 85.1 Plus
Dper\GL12336-PA 400 GL12336-PA 135..395 139..402 610 44.8 Plus
Dper\GL23147-PA 428 GL23147-PA 141..427 124..404 440 34.1 Plus
Dper\GL24384-PA 401 GL24384-PA 153..401 153..403 369 34.8 Plus
Dper\GL24254-PA 316 GL24254-PA 77..314 159..401 368 35.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 20:17:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11133-PC 426 GA11133-PC 123..425 111..412 1360 85.1 Plus
Dpse\GA11133-PB 481 GA11133-PB 123..395 111..382 1209 84.2 Plus
Dpse\GA13141-PA 397 GA13141-PA 135..395 139..402 600 43.8 Plus
Dpse\GA20752-PA 428 GA20752-PA 141..427 124..404 439 34.1 Plus
Dpse\GA15212-PA 385 GA15212-PA 136..369 161..408 406 42 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 20:17:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24081-PA 454 GM24081-PA 1..371 9..385 1482 88.9 Plus
Dsec\GM10721-PA 391 GM10721-PA 130..390 139..402 620 46.1 Plus
Dsec\GM25963-PA 435 GM25963-PA 151..435 131..405 437 35.6 Plus
Dsec\GM21214-PA 397 GM21214-PA 118..367 137..403 425 37.7 Plus
Dsec\GM22814-PA 644 GM22814-PA 398..640 157..403 408 35.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 20:17:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18877-PA 458 GD18877-PA 1..375 9..385 1489 93.9 Plus
Dsim\GD19695-PA 464 GD19695-PA 148..463 53..402 652 45.9 Plus
Dsim\GD15634-PA 519 GD15634-PA 273..515 157..403 394 35.8 Plus
Dsim\GD18876-PA 398 GD18876-PA 111..398 116..403 343 32.1 Plus
Dsim\GD21407-PA 319 GD21407-PA 80..310 159..397 331 33.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 20:17:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14293-PA 381 GJ14293-PA 65..376 64..402 697 45.9 Plus
Dvir\GJ10802-PA 414 GJ10802-PA 134..414 131..405 439 34.4 Plus
Dvir\GJ19458-PA 386 GJ19458-PA 144..370 161..404 412 40.4 Plus
Dvir\GJ10537-PA 314 GJ10537-PA 75..314 159..404 375 36.3 Plus
Dvir\GJ15197-PA 396 GJ15197-PA 150..393 157..404 348 37.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 20:17:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12228-PA 451 GK12228-PA 147..450 109..412 1258 78.9 Plus
Dwil\GK22652-PA 386 GK22652-PA 132..376 139..386 670 51.8 Plus
Dwil\GK10853-PA 404 GK10853-PA 168..403 160..404 458 38.6 Plus
Dwil\GK25688-PA 392 GK25688-PA 154..382 161..403 416 40 Plus
Dwil\GK12226-PA 391 GK12226-PA 135..390 150..402 399 37.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 20:17:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26238-PA 394 GE26238-PA 90..394 108..412 1456 91.8 Plus
Dyak\GE24470-PA 435 GE24470-PA 151..435 131..405 451 35.9 Plus
Dyak\GE17443-PA 394 GE17443-PA 141..368 159..403 417 39.8 Plus
Dyak\GE15526-PA 645 GE15526-PA 399..641 157..403 407 35.4 Plus
Dyak\GE15525-PA 397 GE15525-PA 154..394 157..404 382 36.6 Plus

LP01337.hyp Sequence

Translation from 0 to 1238

> LP01337.hyp
VNRARPLQMADWKRPLETCIALCVLLCVFHVNGQWEFPAQYPEPYRNPNP
NPVPDPTRPPPPPPSPPCGRPPPGSPPPGPPPPGPPPGCPGGPGGPLQHR
QWDNGPRQWQPRRPPPNHHRNFHNIFLNTESKVDGENYNKTAETEDLHDD
FNGRSIVAPGQYPHMAALGFRNENHEIDYKCGGSLISEEFVLTAAHCLTT
HGTSPDIVKIGDIKLKEWELNVAPQRRRVAQIYLHPLYNASLNYHDIGLI
QLNRPVEYTWFVRPVRLWPMNDIPYGKLHTMGYGSTGFAQPQTNILTELD
LSVVPIEQCNSSLPADEGSPHGLLTSQICAHDYEKNRDTCQGDSGGPLQL
NLERRRRRHTSRKHYRYYLVGITSYGAYCRSELPGVYTRVSSYIDWIASI
VWPNYYSEFTNQ*

LP01337.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:15:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG11670-PD 404 CG11670-PD 1..404 9..412 2296 100 Plus
CG14642-PC 392 CG14642-PC 76..391 53..402 777 47 Plus
CG14642-PB 392 CG14642-PB 76..391 53..402 777 47 Plus
snk-PB 435 CG7996-PB 195..435 160..405 452 38.7 Plus
snk-PA 435 CG7996-PA 195..435 160..405 452 38.7 Plus