Clone LP02553 Report

Search the DGRC for LP02553

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:25
Well:53
Vector:pOT2
Associated Gene/TranscriptCG8850-RB
Protein status:LP02553.pep: gold
Sequenced Size:2293

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8850 2009-01-27 Manual selection by Sue Celniker

Clone Sequence Records

LP02553.complete Sequence

2293 bp assembled on 2009-04-10

GenBank Submission: BT082028.1

> LP02553.complete
TTTTAGTAGTCCAGATTGTGTGTGTTCCATAAAAGGCCGTCTTGTGTCTT
GTAGTCTTCCATCTGGATGCATTTGAGCTTTTGTGTTGTCTGCTGCCTGC
ATTTCATTTGTTGCCTTGTACCACAAATTAGCTGTAAATCTAAAAAATGG
ATGATGATGCAGAATACCAGAAGCTCCGGCGAAACATGCAGGGAGCTCAA
GGATCGAGAGAAGGACATCCAGGATCAAATGATGGCATCAGCACAGTAAT
CTACAGCGCGGAAGGAGAAGAGCTTACCATAAATTGTGAGGCCGAATCCG
AGTCATCCGGCCAGCGAGATCAGTGGAGCAGGGGAGTGGAGTTCCTCTTC
TCCTGCATCGCCCTATCCGTTGGCCTTGGCAATGTCTGGCGATTTCCGTT
CATTGCTCTGGAGAATGGCGGTGGCGCCTTTCTCATACCCTACGTGATTG
TGCTCCTGCTGATTGGCAGACCGGTTTACTATCTGGAGGTCATCATTGGT
CAGTTCTCGAGCCGTGGTTGCATCAGAGCCTTCGATATGGCACCTATAAT
GAGGGGTATTGCCTATGGTCAGGTGTATTCCACCGCCTTGGCCACCACCT
ACTACGCCTGCATTATGGCCTTGACCATCAGATATTTGGTGGCTAGTTTC
AGTGAAGTCCTGCCCTGGACATATTGCCTCGTGGAATGGGGCAAAAGTTG
CGTGGCGACGGGAGCCACAGCTGCCAATGACTCATCCATTGTGCAGGGGG
TTTCCTCCGCCGAGCTGTTTTTCACGCAAACAGTTCTGAGGGAGCCCGAA
TCGCTGGACGATAATGGCCTGGGTACTCCCAGTTGGGATCTGGTCTTGTG
TCTCCTGGCCACTTGGGTGATCATCGGCACGATTTTGTCAAAGGGCATTC
GCAGTTCTGGGAAAGCTTCCTATTTCCTGGCCCTGTTTCCCTATGTGATC
ATGATCGTACTGCTCATTCGGGCGGTCACTTTACCAGGTGCCTGGCAGGG
AATTGTGTACTTCCTGAAGCCCCAATGGTCCCAGCTGCTCAATCCGCACG
TGTGGTACGCGGCCATCACACAGATGTTCTTCTCGCTGGCCATCTGCTTC
GGAACGCTGGTCATGTACGCCTCCTTCAATGATTTCAACAAGAATGTGCA
CAAAGATGTGATAATAATCACCACTATAGACTCGCTTACATCCATTCTGG
CTGGTTGCATCATCTTTGGAATTCTGGGCAACCTGGCCTTTGAGACCAAC
ACCAAGGATATTTCGCAGGTTGTCAAAGGTGGAGCTGGTCTAGCGTTCAT
TTCCTATCCAGAGGCCATTGCCAAATTCAAGTACCTTCCCCAACTGTTCG
CCGTTCTGTTCTTCTTCATGCTCCTGGTCCTGGGCATTGGATCGAATATT
GGAATGGCTTCGGCTGTGGTGAATGTGGTTAAGGATCGATTCACCCATTT
GCCCCACTGGCTGCTGGCCGTGAGTGCTTCGATAATTGGATTCCTCTGTG
GCCTGGTGTACATGACTCCGGGCGGACAGTTCGTACTGAATCTCGTCGAC
TTTTATGGCTGCACTTTTATAGCCCTGGTCTTGGCCATTGCAGAATTGTT
GGCAGTGGGCTGGATTTATGGTGTGAAGCGCATCTGCAGCGACATTGAGT
TCATGCTGAATGTGAAGACCAGCTTCTATTGGCGCATCTGCTGGGCCATT
GTGGCACCTGGTCTGATGTTCCTGGTCCTCGTCTATATGCTCTTCAGCTA
CGAACCTCTGACGTACCGAGGTGTTCAGTATCCGCCGGTCTACTATATGG
CTGGATGGATTATCTGGGGACTGGGTGTGCTGCAGTTGCCCTTCTGGGCT
TTGGTGACGATTTACCAGCAGCCAGGAAAGACTTTTGGCAGTAAATTCGG
ACTGGCCATGCAACCCACTGCCAATTGGGGTCCATTGCAGACGCAGAAGT
TCGAGGCCTACATAATCCATCGAAAACGCGAGGCGGACTTTAAGAGCCCA
CGTGGCGGATACTTGTTCGACAATATCTTTGGCTAAAGGACTACTCTAGT
GTATTTTAGTGTTACGCTTTATTATTAATGCAATTGGTAATTAATATATT
CTTAGGCTTTAGGCTTAGCATAAGCATTGAGAGTTATCTGTTTTTAGGTA
ATCTAATTAATTGGATTTGTTTTCAAAAAAAAAAAAACACACACAGACCA
GTGAATATTCAATGGTAGCTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

LP02553.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:30:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG8850.a 2214 CG8850.a 3..2214 1..2211 11020 99.9 Plus
CG8850-RB 2155 CG8850-RB 1..2152 36..2187 10760 100 Plus
CG8850-RA 2120 CG8850-RA 69..2120 161..2211 10220 99.9 Plus
CG8850-RA 2120 CG8850-RA 36..70 1..35 175 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 12:02:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8186370..8187108 1892..1154 3695 100 Minus
chr2R 21145070 chr2R 8187165..8187542 1153..776 1890 100 Minus
chr2R 21145070 chr2R 8185979..8186307 2220..1893 1580 99.4 Minus
chr2R 21145070 chr2R 8187884..8188170 557..271 1435 100 Minus
chr2R 21145070 chr2R 8188230..8188468 272..34 1195 100 Minus
chr2R 21145070 chr2R 8187606..8187827 776..555 1110 100 Minus
chr2L 23010047 chr2L 14847497..14847660 487..324 325 79.9 Minus
chr2R 21145070 chr2R 5684181..5684401 903..1123 295 75.6 Plus
chr2R 21145070 chr2R 5684542..5684717 1212..1387 250 76.1 Plus
chr2L 23010047 chr2L 14844638..14844741 1399..1296 220 80.8 Minus
chr2R 21145070 chr2R 14616372..14616555 1102..919 200 73.9 Minus
chr2R 21145070 chr2R 14617166..14617306 488..348 195 75.9 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:02:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG8850-RB 1890 CG8850-PB 1..1890 147..2036 9450 100 Plus
CG8850-RA 1851 CG8850-PA 1..1851 186..2036 9255 100 Plus
CG1698-RB 1965 CG1698-PB 817..1301 903..1387 400 72.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:47:06 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:02:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG8850-RB 2260 CG8850-RB 40..2260 1..2220 11055 100 Plus
CG8850-RA 2086 CG8850-RA 73..2086 161..2174 10070 100 Plus
CG42700-RJ 4712 CG42700-RJ 3055..3793 1892..1154 3695 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:02:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG8850-PB 629 CG8850-PB 1..629 147..2033 3089 100 Plus
CG8850-PA 616 CG8850-PA 1..616 186..2033 3020 100 Plus
CG1698-PB 654 CG1698-PB 73..654 312..2033 1671 57.1 Plus
CG1698-PA 654 CG1698-PA 73..654 312..2033 1671 57.1 Plus
List-PD 564 CG15088-PD 3..559 270..1946 1584 56.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 12:02:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12299138..12299876 1892..1154 3695 100 Minus
2R 25286936 2R 12299933..12300310 1153..776 1890 100 Minus
2R 25286936 2R 12298744..12299075 2223..1893 1610 99.7 Minus
2R 25286936 2R 12300652..12300938 557..271 1435 100 Minus
2R 25286936 2R 12300998..12301236 272..34 1195 100 Minus
2R 25286936 2R 12300374..12300595 776..555 1110 100 Minus
2L 23513712 2L 14848742..14848905 487..324 325 79.9 Minus
2R 25286936 2R 9796709..9796929 903..1123 295 75.6 Plus
2R 25286936 2R 9797070..9797245 1212..1387 250 76.1 Plus
2L 23513712 2L 14845874..14845977 1399..1296 220 80.8 Minus
2R 25286936 2R 18730015..18730155 488..348 210 76.6 Minus
2R 25286936 2R 18729221..18729404 1102..919 200 73.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:46:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12300337..12301075 1892..1154 3695 100 Minus
2R 25260384 2R 12301132..12301509 1153..776 1890 100 Minus
2R 25260384 2R 12299943..12300274 2223..1893 1620 99.6 Minus
2R 25260384 2R 12301851..12302137 557..271 1435 100 Minus
2R 25260384 2R 12302197..12302435 272..34 1195 100 Minus
2R 25260384 2R 12301573..12301794 776..555 1110 100 Minus
2L 23513712 2L 14848742..14848905 487..324 325 79.8 Minus
2R 25260384 2R 9798011..9798128 1006..1123 245 80.5 Plus
2L 23513712 2L 14845874..14845977 1399..1296 220 80.7 Minus
2R 25260384 2R 18731214..18731354 488..348 210 76.5 Minus
2R 25260384 2R 9798353..9798444 1296..1387 190 80.4 Plus
2R 25260384 2R 12303365..12303400 36..1 180 100 Minus
2R 25260384 2R 18730148..18730221 1237..1164 175 82.4 Minus
2R 25260384 2R 9796877..9796986 339..448 160 76.3 Plus
2R 25260384 2R 18730420..18730514 1102..1008 160 77.8 Minus
Blast to na_te.dros performed on 2014-11-27 12:02:46 has no hits.

LP02553.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 13:38:32 Download gff for LP02553.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8189399..8189433 1..35 100   Minus
chr2R 8188230..8188466 36..272 100 <- Minus
chr2R 8187886..8188168 273..555 100 <- Minus
chr2R 8187607..8187826 556..775 100 <- Minus
chr2R 8187165..8187542 776..1153 100 <- Minus
chr2R 8186370..8187108 1154..1892 100 <- Minus
chr2R 8185979..8186307 1893..2220 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:09:13 Download gff for LP02553.complete
Subject Subject Range Query Range Percent Splice Strand
CG8850-RB 1..1890 147..2036 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:45:22 Download gff for LP02553.complete
Subject Subject Range Query Range Percent Splice Strand
CG8850-RB 1..1890 147..2036 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:18:50 Download gff for LP02553.complete
Subject Subject Range Query Range Percent Splice Strand
CG8850-RB 1..1890 147..2036 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:38:32 Download gff for LP02553.complete
Subject Subject Range Query Range Percent Splice Strand
CG8850-RB 1..1890 147..2036 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-10 11:29:41 Download gff for LP02553.complete
Subject Subject Range Query Range Percent Splice Strand
CG8850-RB 1..2155 36..2191 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:45:22 Download gff for LP02553.complete
Subject Subject Range Query Range Percent Splice Strand
CG8850-RB 1..2155 36..2191 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:18:50 Download gff for LP02553.complete
Subject Subject Range Query Range Percent Splice Strand
CG8850-RB 40..2260 1..2220 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:38:32 Download gff for LP02553.complete
Subject Subject Range Query Range Percent Splice Strand
CG8850-RB 40..2260 1..2220 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 13:38:32 Download gff for LP02553.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12302167..12302201 1..35 100   Minus
2R 12300998..12301234 36..272 100 <- Minus
2R 12300654..12300936 273..555 100 <- Minus
2R 12300375..12300594 556..775 100 <- Minus
2R 12299933..12300310 776..1153 100 <- Minus
2R 12299138..12299876 1154..1892 100 <- Minus
2R 12298747..12299075 1893..2220 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:18:50 Download gff for LP02553.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8189672..8189706 1..35 100   Minus
arm_2R 8188503..8188739 36..272 100 <- Minus
arm_2R 8188159..8188441 273..555 100 <- Minus
arm_2R 8187880..8188099 556..775 100 <- Minus
arm_2R 8187438..8187815 776..1153 100 <- Minus
arm_2R 8186643..8187381 1154..1892 100 <- Minus
arm_2R 8186252..8186580 1893..2220 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:20:38 Download gff for LP02553.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12303366..12303400 1..35 100   Minus
2R 12302197..12302433 36..272 100 <- Minus
2R 12301853..12302135 273..555 100 <- Minus
2R 12301574..12301793 556..775 100 <- Minus
2R 12301132..12301509 776..1153 100 <- Minus
2R 12300337..12301075 1154..1892 100 <- Minus
2R 12299946..12300274 1893..2220 99 <- Minus

LP02553.pep Sequence

Translation from 146 to 2035

> LP02553.pep
MDDDAEYQKLRRNMQGAQGSREGHPGSNDGISTVIYSAEGEELTINCEAE
SESSGQRDQWSRGVEFLFSCIALSVGLGNVWRFPFIALENGGGAFLIPYV
IVLLLIGRPVYYLEVIIGQFSSRGCIRAFDMAPIMRGIAYGQVYSTALAT
TYYACIMALTIRYLVASFSEVLPWTYCLVEWGKSCVATGATAANDSSIVQ
GVSSAELFFTQTVLREPESLDDNGLGTPSWDLVLCLLATWVIIGTILSKG
IRSSGKASYFLALFPYVIMIVLLIRAVTLPGAWQGIVYFLKPQWSQLLNP
HVWYAAITQMFFSLAICFGTLVMYASFNDFNKNVHKDVIIITTIDSLTSI
LAGCIIFGILGNLAFETNTKDISQVVKGGAGLAFISYPEAIAKFKYLPQL
FAVLFFFMLLVLGIGSNIGMASAVVNVVKDRFTHLPHWLLAVSASIIGFL
CGLVYMTPGGQFVLNLVDFYGCTFIALVLAIAELLAVGWIYGVKRICSDI
EFMLNVKTSFYWRICWAIVAPGLMFLVLVYMLFSYEPLTYRGVQYPPVYY
MAGWIIWGLGVLQLPFWALVTIYQQPGKTFGSKFGLAMQPTANWGPLQTQ
KFEAYIIHRKREADFKSPRGGYLFDNIFG*

LP02553.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 09:00:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12074-PA 629 GF12074-PA 2..629 3..629 2875 85.7 Plus
Dana\GF13386-PA 645 GF13386-PA 38..645 17..629 1767 54.5 Plus
Dana\GF13760-PA 565 GF13760-PA 9..560 48..600 1711 57.5 Plus
Dana\GF10859-PA 631 GF10859-PA 1..615 1..620 1688 51.7 Plus
Dana\GF20945-PA 640 GF20945-PA 19..613 48..613 1436 45.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 09:00:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22590-PA 629 GG22590-PA 1..629 1..629 3224 96.7 Plus
Dere\GG24103-PA 654 GG24103-PA 69..654 52..629 1741 56.9 Plus
Dere\GG20951-PA 566 GG20951-PA 2..561 38..600 1708 56.8 Plus
Dere\GG14380-PA 630 GG14380-PA 41..614 39..617 1673 52.6 Plus
Dere\GG18498-PA 641 GG18498-PA 4..614 12..613 1450 45.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 09:00:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22978-PA 1311 GH22978-PA 739..1311 57..629 2636 82.9 Plus
Dgri\GH22941-PA 652 GH22941-PA 52..652 31..629 1790 56.3 Plus
Dgri\GH19805-PA 572 GH19805-PA 21..568 52..600 1608 57 Plus
Dgri\GH10830-PA 732 GH10830-PA 234..732 136..629 1384 51.6 Plus
Dgri\GH24359-PA 584 GH24359-PA 2..578 69..629 1284 44.2 Plus
Dgri\GH10830-PA 732 GH10830-PA 14..219 22..209 486 47.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:00:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG8850-PB 629 CG8850-PB 1..629 1..629 3299 100 Plus
CG8850-PA 616 CG8850-PA 1..616 14..629 3230 100 Plus
CG1698-PB 654 CG1698-PB 73..654 56..629 1834 57.1 Plus
CG1698-PA 654 CG1698-PA 73..654 56..629 1834 57.1 Plus
List-PD 564 CG15088-PD 3..559 42..600 1754 56.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 09:00:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18947-PA 621 GI18947-PA 2..621 3..629 2533 76.7 Plus
Dmoj\GI18430-PA 657 GI18430-PA 36..657 13..629 1814 55.3 Plus
Dmoj\GI20348-PA 563 GI20348-PA 11..558 51..600 1673 57.4 Plus
Dmoj\GI17341-PA 684 GI17341-PA 16..671 28..620 1633 49.2 Plus
Dmoj\GI11052-PA 640 GI11052-PA 27..630 41..623 1415 45.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 09:00:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11260-PA 642 GL11260-PA 1..642 1..629 2720 79.2 Plus
Dper\GL17158-PA 657 GL17158-PA 66..657 48..629 1821 56.5 Plus
Dper\GL11314-PA 556 GL11314-PA 4..551 51..600 1735 57.9 Plus
Dper\GL18425-PA 618 GL18425-PA 44..593 37..614 1579 50.5 Plus
Dper\GL14641-PA 652 GL14641-PA 9..631 8..619 1459 45.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 09:00:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24660-PA 642 GA24660-PA 1..642 1..629 2733 79.6 Plus
Dpse\GA14253-PA 656 GA14253-PA 28..656 13..629 1824 54.3 Plus
Dpse\GA24678-PA 616 GA24678-PA 39..611 31..600 1744 56.6 Plus
Dpse\GA18211-PA 646 GA18211-PA 44..621 37..614 1677 52.4 Plus
Dpse\GA16959-PA 653 GA16959-PA 42..632 41..619 1457 46.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 09:00:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20371-PA 361 GM20371-PA 1..361 269..629 1858 97.5 Plus
Dsec\GM21151-PA 654 GM21151-PA 69..654 52..629 1801 56.6 Plus
Dsec\GM25123-PA 629 GM25123-PA 37..613 43..617 1669 52.2 Plus
Dsec\GM14665-PA 738 GM14665-PA 213..738 117..629 1327 47.8 Plus
Dsec\GM20370-PA 267 GM20370-PA 1..266 1..265 1308 95.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 09:00:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25852-PA 587 GD25852-PA 1..587 1..629 2723 85.1 Plus
Dsim\GD10682-PA 939 GD10682-PA 354..939 52..629 1815 56.9 Plus
Dsim\GD25364-PA 561 GD25364-PA 3..556 42..600 1712 57 Plus
Dsim\GD14159-PA 629 GD14159-PA 51..613 57..617 1668 53.4 Plus
Dsim\GD16262-PA 643 GD16262-PA 26..622 44..619 1430 45.8 Plus
Dsim\GD10682-PA 939 GD10682-PA 113..229 52..168 449 67.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 09:00:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21553-PA 627 GJ21553-PA 2..627 3..629 2568 76.4 Plus
Dvir\GJ21513-PA 648 GJ21513-PA 45..648 31..629 1845 57.3 Plus
Dvir\GJ22072-PA 821 GJ22072-PA 2..510 37..550 1607 58.1 Plus
Dvir\GJ14810-PA 637 GJ14810-PA 29..631 48..629 1416 45.5 Plus
Dvir\GJ11796-PA 706 GJ11796-PA 221..693 151..620 1332 52.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 09:00:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21412-PA 623 GK21412-PA 2..623 3..629 2622 78.4 Plus
Dwil\GK22113-PA 624 GK22113-PA 2..624 3..629 2496 75.7 Plus
Dwil\GK15957-PA 656 GK15957-PA 36..656 7..629 1831 55.3 Plus
Dwil\GK20711-PA 564 GK20711-PA 2..561 37..600 1783 57.8 Plus
Dwil\GK23734-PA 644 GK23734-PA 51..644 48..629 1631 50.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 09:00:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13460-PA 629 GE13460-PA 1..629 1..629 3178 95.2 Plus
Dyak\GE19301-PA 655 GE19301-PA 65..655 48..629 1805 56.6 Plus
Dyak\GE13889-PA 568 GE13889-PA 5..561 42..600 1706 56.5 Plus
Dyak\GE20810-PA 629 GE20810-PA 41..629 46..629 1672 51.9 Plus
Dyak\GE16816-PA 641 GE16816-PA 4..614 12..613 1431 44.9 Plus

LP02553.hyp Sequence

Translation from 146 to 2035

> LP02553.hyp
MDDDAEYQKLRRNMQGAQGSREGHPGSNDGISTVIYSAEGEELTINCEAE
SESSGQRDQWSRGVEFLFSCIALSVGLGNVWRFPFIALENGGGAFLIPYV
IVLLLIGRPVYYLEVIIGQFSSRGCIRAFDMAPIMRGIAYGQVYSTALAT
TYYACIMALTIRYLVASFSEVLPWTYCLVEWGKSCVATGATAANDSSIVQ
GVSSAELFFTQTVLREPESLDDNGLGTPSWDLVLCLLATWVIIGTILSKG
IRSSGKASYFLALFPYVIMIVLLIRAVTLPGAWQGIVYFLKPQWSQLLNP
HVWYAAITQMFFSLAICFGTLVMYASFNDFNKNVHKDVIIITTIDSLTSI
LAGCIIFGILGNLAFETNTKDISQVVKGGAGLAFISYPEAIAKFKYLPQL
FAVLFFFMLLVLGIGSNIGMASAVVNVVKDRFTHLPHWLLAVSASIIGFL
CGLVYMTPGGQFVLNLVDFYGCTFIALVLAIAELLAVGWIYGVKRICSDI
EFMLNVKTSFYWRICWAIVAPGLMFLVLVYMLFSYEPLTYRGVQYPPVYY
MAGWIIWGLGVLQLPFWALVTIYQQPGKTFGSKFGLAMQPTANWGPLQTQ
KFEAYIIHRKREADFKSPRGGYLFDNIFG*

LP02553.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:46:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG8850-PB 629 CG8850-PB 1..629 1..629 3299 100 Plus
CG8850-PA 616 CG8850-PA 1..616 14..629 3230 100 Plus
CG1698-PB 654 CG1698-PB 73..654 56..629 1834 57.1 Plus
CG1698-PA 654 CG1698-PA 73..654 56..629 1834 57.1 Plus
List-PD 564 CG15088-PD 3..559 42..600 1754 56.7 Plus