Clone LP04237 Report

Search the DGRC for LP04237

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:42
Well:37
Vector:pOT2
Associated Gene/TranscriptTfIIA-L-RB
Protein status:LP04237.pep: gold
Sequenced Size:1594

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
TfIIA-L-RA 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

LP04237.complete Sequence

1594 bp assembled on 2010-12-10

GenBank Submission: BT126001.1

> LP04237.complete
AGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAG
AGAGAGAGAGAGAGCTAATTCTTCGCTTCGCCCATTTATAATTCAGCAAA
TACGTCAATTAGCCCCACCAGCGAACGGAAAAGCCTCAAGCTGGCGGAGA
AAAAGGTCCAAATGGCGCTATGCCAGACATCGGTGCTGAAGGTGTACCAT
GCCGTGATCGAGGACGTCATCACAAATGTGCGGGACGCGTTCCTGGACGA
GGGCGTCGACGAACAGGTGCTGCAGGAGATGAAGCAGGTCTGGCGCAACA
AGTTGCTTGCTAGCAAGGCCGTCGAGCTGAGCCCGGACTCCGGCGATGGC
TCCCATCCGCCACCCATCGTGGCCAACAATCCAAAGGCAGCGAATGCCAA
GGCCAAGAAGGCCGCCGCCGCAACCGCGGTCACATCACACCAACATATCG
GCGGCAACAGCTCCATGTCCTCGCTGGTGGGGCTTAAGTCGTCCGCTGGA
ATGGCCGCCGGCAGCGGCATAAGGAACGGGCTGGTGCCCATCAAGCAGGA
AGTCAACTCACAGAATCCACCGCCACTGCATCCTACCTCGGCTGCAAGCA
TGATGCAGAAACAGCAGCAGGCGGCGAGCAGTGGACAGGGTTCCATTCCA
ATTGTGGCCACGCTGGACCCCAATCGCATTATGCCTGTTAACATCACGCT
GCCATCGCCAGCCGGCTCTGCCAGTTCGGAATCTCGAGTGCTCACCATAC
AAGTGCCTGCCTCCGCGCTGCAGGAGAATCAGTTGACCCAAATTCTGACG
GCCCACCTGATTTCATCCATCATGTCCTTGCCCACCACGTTGGCCTCGTC
TGTGCTTCAGCAGCACGTAAACGCAGCGCTAAGCAGCGCCAATCACCAGA
AAACTCTTGCCGCCGCCAAGCAATTGGACGGTGCCCTGGACTCCTCCGAT
GAGGATGAAAGCGAGGAGAGCGACGACAACATCGACAACGATGACGACGA
TGACCTAGACAAGGACGATGACGAGGATGCGGAGCACGAGGATGCTGCCG
AGGAGGAGCCGCTCAACAGCGAAGACGATGTCACCGACGAAGACTCTGCC
GAAATGTTTGACACAGATAACGTGATTGTTTGTCAGTACGATAAGATCAC
CAGGTCGCGAAACAAATGGAAATTCTATCTCAAAGATGGCATCATGAACA
TGCGGGGCAAGGACTACGTGTTCCAGAAATCGAATGGCGACGCCGAGTGG
TAATGGATGGCAGTTGAGCGAACAGCGGCGGCAGTGTGAATATATATATT
AACAAAAGACATCAAACAAAAAGCCTCATCGAATGCGCCTTCAGCCCTGG
ACGACAATGGCTAACCAGACCGGACTCTGCATCACTGGGCAACATGACCA
AGCAACACCGTCTGCACAGAAAGCAACGTACTCGGGCCGACACTGTATCT
TATTTTAGTTCCATCTGTTTTGTATTACGATAGCTTAAGGGTGTGTTGCA
ACCAACCATCTCGATTAAATGTATTAGAGTGCCGCATAACTTTTGTGTCA
ATAAACAAAAACATTTGTGAAAGTTAAAAAAAAAAAAAAAAAAA

LP04237.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:36:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 23078962..23079393 1144..1575 2130 99.5 Plus
chr3R 27901430 chr3R 23078018..23078325 385..692 1525 99.7 Plus
chr3R 27901430 chr3R 23078656..23078900 901..1145 1225 100 Plus
chr3R 27901430 chr3R 23078386..23078593 693..900 1040 100 Plus
chr3R 27901430 chr3R 23077457..23077659 185..387 1015 100 Plus
chr3R 27901430 chr3R 23076434..23076559 64..189 615 99.2 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:36:44
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIA-L-RB 1092 CG5930-PB 1..1092 162..1253 5460 100 Plus
TfIIA-L-RA 1101 CG5930-PA 1..1101 162..1253 5335 99.2 Plus
TfIIA-L-RC 975 CG5930-PC 1..975 279..1253 4875 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:36:43
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIA-L-RB 1586 CG5930-RB 75..1586 64..1575 7560 100 Plus
TfIIA-L-RA 1595 CG5930-RA 75..1595 64..1575 7435 99.4 Plus
TfIIA-L-RC 1440 CG5930-RC 50..1440 185..1575 6955 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:36:47
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIA-L-PB 363 CG5930-PB 1..363 162..1250 1197 100 Plus
TfIIA-L-PA 366 CG5930-PA 1..366 162..1250 1183 96.7 Plus
TfIIA-L-PC 324 CG5930-PC 1..324 279..1250 1003 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:36:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27256032..27256464 1144..1576 2165 100 Plus
3R 32079331 3R 27255088..27255395 385..692 1540 100 Plus
3R 32079331 3R 27255726..27255970 901..1145 1225 100 Plus
3R 32079331 3R 27255456..27255663 693..900 1040 100 Plus
3R 32079331 3R 27254527..27254729 185..387 1015 100 Plus
3R 32079331 3R 27253504..27253629 64..189 615 99.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:03:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 26996863..26997295 1144..1576 2165 100 Plus
3R 31820162 3R 26995919..26996226 385..692 1540 100 Plus
3R 31820162 3R 26996557..26996801 901..1145 1225 100 Plus
3R 31820162 3R 26996287..26996494 693..900 1040 100 Plus
3R 31820162 3R 26995358..26995560 185..387 1015 100 Plus
3R 31820162 3R 26994335..26994460 64..189 615 99.2 Plus
Blast to na_te.dros performed 2014-11-27 16:36:42
Subject Length Description Subject Range Query Range Score Percent Strand
Idefix 7411 Idefix DME9736 7411bp Derived from AJ009736 (e1371475) (Rel. 58, Last updated, Version 1). 5723..5805 937..1022 116 62.8 Plus

LP04237.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:54:46 Download gff for LP04237.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 23078964..23079393 1146..1575 99   Plus
chr3R 23078850..23078900 1095..1145 100 -> Plus
chr3R 23078656..23078701 901..946 100 == Plus
chr3R 23078386..23078593 693..900 100 -> Plus
chr3R 23078020..23078325 387..692 99 -> Plus
chr3R 23077458..23077658 186..386 100 -> Plus
chr3R 23076434..23076555 64..185 100 -> Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2010-12-10 09:47:35 Download gff for LP04237.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIA-L-RB 1..1092 162..1253 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:35:24 Download gff for LP04237.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIA-L-RB 1..1092 162..1253 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:54:46 Download gff for LP04237.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIA-L-RB 1..1092 162..1253 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2010-12-10 09:47:34 Download gff for LP04237.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIA-L-RB 75..1586 64..1575 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:35:24 Download gff for LP04237.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIA-L-RB 75..1586 64..1575 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:54:46 Download gff for LP04237.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIA-L-RB 75..1586 64..1575 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:54:46 Download gff for LP04237.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27256034..27256463 1146..1575 100   Plus
3R 27255726..27255970 901..1145 100 -> Plus
3R 27255456..27255663 693..900 100 -> Plus
3R 27255090..27255395 387..692 100 -> Plus
3R 27254528..27254728 186..386 100 -> Plus
3R 27253504..27253625 64..185 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:35:24 Download gff for LP04237.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 23081756..23082185 1146..1575 100   Plus
arm_3R 23081448..23081692 901..1145 100 -> Plus
arm_3R 23081178..23081385 693..900 100 -> Plus
arm_3R 23080812..23081117 387..692 100 -> Plus
arm_3R 23080250..23080450 186..386 100 -> Plus
arm_3R 23079226..23079347 64..185 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:52:48 Download gff for LP04237.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26996865..26997294 1146..1575 100   Plus
3R 26996557..26996801 901..1145 100 -> Plus
3R 26996287..26996494 693..900 100 -> Plus
3R 26995921..26996226 387..692 100 -> Plus
3R 26995359..26995559 186..386 100 -> Plus
3R 26994335..26994456 64..185 100 -> Plus

LP04237.pep Sequence

Translation from 161 to 1252

> LP04237.pep
MALCQTSVLKVYHAVIEDVITNVRDAFLDEGVDEQVLQEMKQVWRNKLLA
SKAVELSPDSGDGSHPPPIVANNPKAANAKAKKAAAATAVTSHQHIGGNS
SMSSLVGLKSSAGMAAGSGIRNGLVPIKQEVNSQNPPPLHPTSAASMMQK
QQQAASSGQGSIPIVATLDPNRIMPVNITLPSPAGSASSESRVLTIQVPA
SALQENQLTQILTAHLISSIMSLPTTLASSVLQQHVNAALSSANHQKTLA
AAKQLDGALDSSDEDESEESDDNIDNDDDDDLDKDDDEDAEHEDAAEEEP
LNSEDDVTDEDSAEMFDTDNVIVCQYDKITRSRNKWKFYLKDGIMNMRGK
DYVFQKSNGDAEW*

LP04237.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:57:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16279-PA 364 GF16279-PA 1..364 1..363 1333 83.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:57:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11539-PA 366 GG11539-PA 1..366 1..363 1513 91.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:57:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19494-PA 369 GH19494-PA 1..369 1..363 1185 81.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:57:42
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIA-L-PB 363 CG5930-PB 1..363 1..363 1838 100 Plus
TfIIA-L-PA 366 CG5930-PA 1..366 1..363 1824 99.2 Plus
TfIIA-L-PC 324 CG5930-PC 1..324 40..363 1644 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:57:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22255-PA 381 GI22255-PA 1..381 1..363 1178 76.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:57:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24482-PA 177 GL24482-PA 1..177 1..175 490 60.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:57:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19238-PB 359 GA19238-PB 1..359 1..363 1274 82.4 Plus
Dpse\GA19238-PA 356 GA19238-PA 1..356 1..363 1237 84.3 Plus
Dpse\GA19238-PC 317 GA19238-PC 1..317 40..363 1029 82.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:57:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10381-PA 366 GM10381-PA 1..366 1..363 1500 97 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:57:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21332-PA 115 GD21332-PA 6..115 254..363 564 98.2 Plus
Dsim\GD15189-PA 81 GD15189-PA 1..77 1..77 404 97.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:57:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24046-PA 379 GJ24046-PA 1..379 1..363 1151 78.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:58:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22574-PA 379 GK22574-PA 1..379 1..363 1288 80.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:58:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23726-PA 366 GE23726-PA 1..366 1..363 1528 92.3 Plus

LP04237.hyp Sequence

Translation from 161 to 1252

> LP04237.hyp
MALCQTSVLKVYHAVIEDVITNVRDAFLDEGVDEQVLQEMKQVWRNKLLA
SKAVELSPDSGDGSHPPPIVANNPKAANAKAKKAAAATAVTSHQHIGGNS
SMSSLVGLKSSAGMAAGSGIRNGLVPIKQEVNSQNPPPLHPTSAASMMQK
QQQAASSGQGSIPIVATLDPNRIMPVNITLPSPAGSASSESRVLTIQVPA
SALQENQLTQILTAHLISSIMSLPTTLASSVLQQHVNAALSSANHQKTLA
AAKQLDGALDSSDEDESEESDDNIDNDDDDDLDKDDDEDAEHEDAAEEEP
LNSEDDVTDEDSAEMFDTDNVIVCQYDKITRSRNKWKFYLKDGIMNMRGK
DYVFQKSNGDAEW*

LP04237.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:46:46
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIA-L-PB 363 CG5930-PB 1..363 1..363 1838 100 Plus
TfIIA-L-PA 366 CG5930-PA 1..366 1..363 1824 99.2 Plus
TfIIA-L-PC 324 CG5930-PC 1..324 40..363 1644 100 Plus