Clone LP04622 Report

Search the DGRC for LP04622

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:46
Well:22
Vector:pOT2
Associated Gene/TranscriptSkp2-RB
Protein status:LP04622.pep: wuzgold
Sequenced Size:1939

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9772-RB 2009-06-22 Replacement based on scoring

Clone Sequence Records

LP04622.complete Sequence

1939 bp assembled on 2009-12-14

GenBank Submission: BT120039.1

> LP04622.complete
CTGCTCGTACGTTTGCCAAGCAACTTCGTAGAGGTTCATTTGGGAATCCT
TCTCGCCTTCCTTAGTACAGCATTATGGCGGTCTTGTTTTTATCGTCACA
TGGCGCCTCCAGGCATTGGCGGTTGCGGAGGCCGAGTCGCTGGGCGTACA
ACAGGATGGCGATATTCAGCAGCACAACGACGGTGGATACCACGACCAGA
AAGCGCTCGACTAATAAGAACCACGTCTCTGTTGTGGGCGCTCTAGTTTC
CACTACGAAGTCATCGCACTACGAGCACCCTTCCTCGCCCTCGGCACTAA
CTTTTGAGGCCCTAGAAGAGATGGGAATCGGAATGCTTGATTCCGAAGAA
AGCAGCTCCTCAGCCCTCTCGGCCATCGCTTTGGCGGTTAGCGCCACCAG
CGACGACAACTCAAATGAGACGACCCCGTGCGCCAGTGTGTCGCGCATGG
CGCACCAGCTACAGCACACGCAACGGCTAAGTCTGGGCTCTACGGGGGAC
ATCACACTGGATAGCCCAGCTGTGGAGGATTCACTGTCGATGTCCCGTCA
ATCGGCCGAGAAGCTGCAGATTCTGGCGCAGGCTAAGCGCTCGTCGTTGG
GTTCTGAAGGTAGCGGCAATTCAAACTCGCCCAGCAAACGTTTGCGCAAC
CCCCTGGCTGCAGTCACCTGTAACAACCAGATTGATGGGACTGCTTCGCT
CAATTTTCAGCCATCAACCAGCAGGTTGGCGCAAGTTCGCCAGGCAAAAA
AGCCCTCGACAACAAATATTACAACCCGAATAGTGGCAGCGGACAGTTTC
TTTGTGTTTCGCACCCCGGCCATGAGTGCCCACATCAACAGCGGCATAAA
CTACTTTGAAAGACTTTCAGACGAAATACTACTTGACATCTTTAAGTGGC
TCCCGAAGAAGACGCTGCTGCGCATGGCTACCGTTTGTCGACGCTTTAAC
CGCTGCTCTCGCGATGAGACTTTGTGGACAAGGCTAGATTTGGGTTTGCG
GACAATTAGACCAGGTGCCCTCGAGCAAATTGTACGGCGGGGAGTCCTTG
TAATACGTCTGGCCCAGACTAGTATCCAGGAGCCCGCATTTGCACCATAT
ACAGAAGTGTTTAGGACCCGATTACAATATCTTGACCTGAGTATGGCTTC
CATCACCCGAAGCTCACTGCTGACACTATTGTCCCACTGCCGCCAGCTAA
AGAAAATAAGCTTAGAGAATATTGAGCTCGATGATGACATCTGTGCAGAG
ATCGCAAAGAATGAAGCTTTGGAGGCGGTCAATCTGACTATGGCTAGTGG
CCTGACGTCCAACAGTGTTCGCCTGATGATGGAGTCACTTACCAGCCTAA
GCAGCTTAAACATATCGTGGACTGACCTAAGTGCGGATGCTGTTACGGCG
TTGGTTACCCACATTTCCCCCAACTTAATTCGGCTCAATATCGCTGGCTG
CCGCCGCGTTTTGTTTGACTCGCATGTTGCAACCCTGCAAAAACGGTGTC
CTCAGTTGTTGGAGCTTGATCTATCTGATTGCAATAGTCTAACACCAACA
GTCATTACTGCAATTATGAAGTTCAAGATGCTGGAATATTTGTCCGTCTC
CCGATGCTATCTTATTCCAGCAACCAAATTTATTGAACTTAAGAGTATGC
CCTCGCTAACCTATTTAGACATATTTGGGATGCTGTCGGACACTGCAATG
GAAGTCCTTGAGAAACAACTGCCAAAAATGGGTATAAACAAATTCATTCA
CAGTTCGGTATCCCGCCCGACTGTTGGCACGCGACGCACCTCCATTTGGG
GTCTGCGCACGCGCGACTAAGTCTCGACTCTGCTGCTTCCGTTACCATTT
GAATTTGTTTTGCTGCGTAAGCCACCCGTAACGCAGTTATTTTATTCTCA
ATTCAACAACATAAATAATCACATTAAAAAAAAAAAAAA

LP04622.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:47:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG9772-RB 1942 CG9772-RB 1..1925 1..1925 9625 100 Plus
CG9772-RA 2075 CG9772-RA 189..1920 194..1925 8660 100 Plus
CG9772.b 1897 CG9772.b 134..1574 194..1634 7205 100 Plus
CG9772.b 1897 CG9772.b 1589..1880 1634..1925 1460 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:41:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 162189..163065 1073..197 4385 100 Minus
chr3R 27901430 chr3R 161729..162128 1473..1074 2000 100 Minus
chr3R 27901430 chr3R 161158..161449 1925..1634 1460 100 Minus
chr3R 27901430 chr3R 165087..165285 199..1 995 100 Minus
chr3R 27901430 chr3R 161506..161665 1633..1474 800 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:41:21
Subject Length Description Subject Range Query Range Score Percent Strand
Skp2-RE 1680 CG9772-PE 54..1680 194..1820 8135 100 Plus
Skp2-RA 1680 CG9772-PA 54..1680 194..1820 8135 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:49:20 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:41:20
Subject Length Description Subject Range Query Range Score Percent Strand
Skp2-RE 1853 CG9772-RE 122..1853 194..1925 8660 100 Plus
Skp2-RA 2412 CG9772-RA 122..1853 194..1925 8660 100 Plus
CG1103-RB 1223 CG1103-RB 676..874 199..1 995 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:41:24
Subject Length Description Subject Range Query Range Score Percent Strand
Skp2-PE 559 CG9772-PE 25..559 213..1817 2345 100 Plus
Skp2-PA 559 CG9772-PA 25..559 213..1817 2345 100 Plus
CG1103-PB 230 CG1103-PB 197..230 65..166 177 100 Plus
CG1103-PA 230 CG1103-PA 197..230 65..166 177 100 Plus
CG9003-PB 651 CG9003-PB 176..472 648..1607 165 23.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:41:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4336469..4337345 1073..197 4385 100 Minus
3R 32079331 3R 4336009..4336408 1473..1074 2000 100 Minus
3R 32079331 3R 4335438..4335729 1925..1634 1460 100 Minus
3R 32079331 3R 4339367..4339565 199..1 995 100 Minus
3R 32079331 3R 4335786..4335945 1633..1474 800 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:44:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 4077300..4078176 1073..197 4385 100 Minus
3R 31820162 3R 4076840..4077239 1473..1074 2000 100 Minus
3R 31820162 3R 4076269..4076560 1925..1634 1460 100 Minus
3R 31820162 3R 4080198..4080396 199..1 995 100 Minus
3R 31820162 3R 4076617..4076776 1633..1474 800 100 Minus
Blast to na_te.dros performed on 2014-11-26 19:41:18 has no hits.

LP04622.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:58:06 Download gff for LP04622.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 165087..165285 1..199 100   Minus
chr3R 162189..163062 200..1073 100 <- Minus
chr3R 161729..162128 1074..1473 100 <- Minus
chr3R 161506..161665 1474..1633 100 <- Minus
chr3R 161158..161449 1634..1925 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-12-14 11:37:30 Download gff for LP04622.complete
Subject Subject Range Query Range Percent Splice Strand
CG9772-RB 1..1746 75..1820 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:28:36 Download gff for LP04622.complete
Subject Subject Range Query Range Percent Splice Strand
CG9772-RB 1..1746 75..1820 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:28:32 Download gff for LP04622.complete
Subject Subject Range Query Range Percent Splice Strand
Skp2-RB 1..1746 75..1820 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:58:06 Download gff for LP04622.complete
Subject Subject Range Query Range Percent Splice Strand
Skp2-RA 54..1680 194..1820 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-12-14 11:37:30 Download gff for LP04622.complete
Subject Subject Range Query Range Percent Splice Strand
CG9772-RB 1..1925 1..1925 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:28:36 Download gff for LP04622.complete
Subject Subject Range Query Range Percent Splice Strand
CG9772-RB 1..1925 1..1925 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:28:32 Download gff for LP04622.complete
Subject Subject Range Query Range Percent Splice Strand
Skp2-RB 1..1925 1..1925 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:58:06 Download gff for LP04622.complete
Subject Subject Range Query Range Percent Splice Strand
Skp2-RA 122..1853 194..1925 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:58:06 Download gff for LP04622.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4339367..4339565 1..199 100   Minus
3R 4336469..4337342 200..1073 100 <- Minus
3R 4336009..4336408 1074..1473 100 <- Minus
3R 4335786..4335945 1474..1633 100 <- Minus
3R 4335438..4335729 1634..1925 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:28:32 Download gff for LP04622.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 165089..165287 1..199 100   Minus
arm_3R 162191..163064 200..1073 100 <- Minus
arm_3R 161731..162130 1074..1473 100 <- Minus
arm_3R 161508..161667 1474..1633 100 <- Minus
arm_3R 161160..161451 1634..1925 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:14:23 Download gff for LP04622.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4080198..4080396 1..199 100   Minus
3R 4077300..4078173 200..1073 100 <- Minus
3R 4076840..4077239 1074..1473 100 <- Minus
3R 4076617..4076776 1474..1633 100 <- Minus
3R 4076269..4076560 1634..1925 100 <- Minus

LP04622.pep Sequence

Translation from 74 to 1819

> LP04622.pep
MAVLFLSSHGASRHWRLRRPSRWAYNRMAIFSSTTTVDTTTRKRSTNKNH
VSVVGALVSTTKSSHYEHPSSPSALTFEALEEMGIGMLDSEESSSSALSA
IALAVSATSDDNSNETTPCASVSRMAHQLQHTQRLSLGSTGDITLDSPAV
EDSLSMSRQSAEKLQILAQAKRSSLGSEGSGNSNSPSKRLRNPLAAVTCN
NQIDGTASLNFQPSTSRLAQVRQAKKPSTTNITTRIVAADSFFVFRTPAM
SAHINSGINYFERLSDEILLDIFKWLPKKTLLRMATVCRRFNRCSRDETL
WTRLDLGLRTIRPGALEQIVRRGVLVIRLAQTSIQEPAFAPYTEVFRTRL
QYLDLSMASITRSSLLTLLSHCRQLKKISLENIELDDDICAEIAKNEALE
AVNLTMASGLTSNSVRLMMESLTSLSSLNISWTDLSADAVTALVTHISPN
LIRLNIAGCRRVLFDSHVATLQKRCPQLLELDLSDCNSLTPTVITAIMKF
KMLEYLSVSRCYLIPATKFIELKSMPSLTYLDIFGMLSDTAMEVLEKQLP
KMGINKFIHSSVSRPTVGTRRTSIWGLRTRD*

LP04622.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:55:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16815-PA 561 GF16815-PA 19..561 41..581 2151 79.1 Plus
Dana\GF15907-PA 383 GF15907-PA 33..357 73..391 1011 64 Plus
Dana\GF11789-PA 637 GF11789-PA 226..458 261..511 188 26.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:55:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11654-PA 561 GG11654-PA 19..561 41..581 2451 91.7 Plus
Dere\GG22638-PA 641 GG22638-PA 230..462 261..511 195 26.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:55:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18735-PA 579 GH18735-PA 20..579 42..581 1780 68.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:55:35
Subject Length Description Subject Range Query Range Score Percent Strand
Skp2-PE 559 CG9772-PE 19..559 41..581 2693 100 Plus
Skp2-PA 559 CG9772-PA 19..559 41..581 2693 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:55:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22887-PA 589 GI22887-PA 20..589 42..581 1786 66.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:55:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12326-PA 533 GL12326-PA 19..515 41..541 1805 74.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:55:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22024-PB 548 GA22024-PB 1..548 30..581 2099 76.1 Plus
Dpse\GA22024-PA 555 GA22024-PA 19..555 41..581 2072 76.7 Plus
Dpse\GA22024-PC 341 GA22024-PC 19..308 41..334 962 71.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:55:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10708-PA 557 GM10708-PA 19..557 41..581 2542 94.8 Plus
Dsec\GM20416-PA 653 GM20416-PA 242..474 261..511 197 26.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:55:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19685-PA 557 GD19685-PA 19..557 41..581 2553 95.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:55:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14183-PA 584 GJ14183-PA 20..584 42..581 1844 69.9 Plus
Dvir\GJ21964-PA 660 GJ21964-PA 249..481 261..511 185 24.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:55:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11443-PA 590 GK11443-PA 19..590 41..581 1893 67.3 Plus
Dwil\GK21630-PA 634 GK21630-PA 223..455 261..511 184 26 Plus
Dwil\GK11217-PA 764 GK11217-PA 393..678 260..552 160 26 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:55:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25359-PA 561 GE25359-PA 19..561 41..581 2443 89.3 Plus
Dyak\GE13509-PA 640 GE13509-PA 229..461 261..511 197 26.6 Plus

LP04622.hyp Sequence

Translation from 74 to 1819

> LP04622.hyp
MAVLFLSSHGASRHWRLRRPSRWAYNRMAIFSSTTTVDTTTRKRSTNKNH
VSVVGALVSTTKSSHYEHPSSPSALTFEALEEMGIGMLDSEESSSSALSA
IALAVSATSDDNSNETTPCASVSRMAHQLQHTQRLSLGSTGDITLDSPAV
EDSLSMSRQSAEKLQILAQAKRSSLGSEGSGNSNSPSKRLRNPLAAVTCN
NQIDGTASLNFQPSTSRLAQVRQAKKPSTTNITTRIVAADSFFVFRTPAM
SAHINSGINYFERLSDEILLDIFKWLPKKTLLRMATVCRRFNRCSRDETL
WTRLDLGLRTIRPGALEQIVRRGVLVIRLAQTSIQEPAFAPYTEVFRTRL
QYLDLSMASITRSSLLTLLSHCRQLKKISLENIELDDDICAEIAKNEALE
AVNLTMASGLTSNSVRLMMESLTSLSSLNISWTDLSADAVTALVTHISPN
LIRLNIAGCRRVLFDSHVATLQKRCPQLLELDLSDCNSLTPTVITAIMKF
KMLEYLSVSRCYLIPATKFIELKSMPSLTYLDIFGMLSDTAMEVLEKQLP
KMGINKFIHSSVSRPTVGTRRTSIWGLRTRD*

LP04622.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:12:14
Subject Length Description Subject Range Query Range Score Percent Strand
Skp2-PE 559 CG9772-PE 19..559 41..581 2693 100 Plus
Skp2-PA 559 CG9772-PA 19..559 41..581 2693 100 Plus