Clone LP04771 Report

Search the DGRC for LP04771

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:47
Well:71
Vector:pOT2
Associated Gene/TranscriptPAN2-RA
Protein status:LP04771.pep: gold
Sequenced Size:4047

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8232 2008-04-29 Release 5.5 accounting
CG8232 2008-04-29 Picked prior to 5.5
CG8232 2008-08-15 Release 5.9 accounting
CG8232 2008-12-18 5.12 accounting

Clone Sequence Records

LP04771.complete Sequence

4047 bp assembled on 2007-10-09

GenBank Submission: BT031142

> LP04771.complete
GGTCACTCTAATCGGTGCAACGCAAAAACGGCTGGCAGTTTTGAGCGAAA
TTTGTTAAAAAATAAACAATAAAAAGTCGCGTGGGCATCGGCGTGCGGCA
GATGGATTACGTGTATTGCGGCACCGACCCCATCGGGGCCTCCGAAGACA
TACTAAGTGTTTATGACGCGGGATCTGCGCCGGGAAACGGGCACTTTTCG
CCCAGCTTCAATGGATTCAACATCGGCACCACCGATCCGGAATATGTGGA
GCTTGTGCCCGTGCTTGCCGACGGCGGGGAGCACTTCGGCGTTTCCAGCG
TGGCGTTCGACGACTACGAAGAGCTGCTGTGGATGGGCAACCAGGGCGGC
CACGTCACATCGTACTACACAAACTCCATGCAGAAGTACACATCCTTTCA
GGTCCACGCCACCGACATTGTGCGCGACATCTCCACCCTGGACTCCGGAG
TGCTGGCGCTCACGCAGACCTCGCTGCGTCATCAGATCCGCAGGGGTCTG
CCCAAGTTTACCTTCAAATCGAACAACATGAAGGAGATGGTGAGCATGCT
GCAGCTATCACCGCATCGTCTGGTCATGGCCGGACTGCAGGACGAGCTTA
TCGACTTCGACCTGCGCACGCTCAAGGAAACCCGCATAGAGCATGTGGGT
GCCGGCGGATGCACGGTGCTACGCAAGAATTCACGTTATCTGTTTGCCGG
CGACCAGCTGGGAACGGTAACGTTGCGCGACCTGAACAGCCTGAGTGTTC
AGCACACAATCAAGACGCACACCAACATCCTTTCGGACTTCAGTGTCCAG
GGAAATCTGCTAATCTCTTGCGGCTACAGCGGAAGGCAAAATAACCTGGC
CATCGACCGCTTCCTAATGGTCTACGATCTGCGCATGCTGCGCCTGATCG
CGCCCATTCAAGTGATGATTGATCCGCAGATGTTGAAGTTCCTGCCATCG
CTGACATCCCAACTGGCCGTCGTGTCCAGCTACGGCCAGGTTCAGCTGGT
GGACACTGTGGAGCTCAGCGAGCCGCGAGTATCCATGTACCAGATCAACA
CCAACGGCAGCCAGTGCCTCAGCTTCGACATTAGCTCCTCTTCACAGGCC
ATGGCATTTGGGGACCAGTCGGGCCACATCAACATGATTGCCGCTGTACA
AACGCCTCAGCCGCAGTTCAATCTCTACTCGCGAAGCACAGAGTTTGCGG
ACGTGGTGCCACAGCTGCCGATGGTCTCCATTACGGACACCAACTTTCCG
CTATCGTCGGTCATGCTACCGCACTTGACGACGGGCACACAATGGTTCTC
AGATTGGCCGGAGGAACTGCTGCGCTACCGCTACCACAGGCCCAAGACCA
TTGATCCCGAAGTGCTGAGCAACATGAAAATGCAGGGACCGATTGGATAC
TCGCCAAACCCACGCACCGCCCGTCGTAATCAAATTCCGTACGTGATTGA
GCAGGGCGGCGTGTGCAGTCCGAACGGAAATGGAACTGCGGCGGCGACCA
AGGCGGAGAACGGTGTGAAAATCATTCCACGGCGGTATCGCAAAGTCGAG
CTGAAGTACACGAAGCTGGGCACCCAGGACTTTGACTTTGACCAGCATAA
TCAAACATGTTTCGCGGGGCTGGAGGCAACGCTACCGAACTCCTACTGCA
ATGCTATGCTACAGATTTTGTATTTCACCGACGCGCTTCGCGTGAAGCTG
CTGGAGCATTCGTGCATCAAGGAGTTTTGCCTGTCCTGCGAACTAGGGTT
CCTCTTCAACATGCTGGATAAAAGTACCGCTTCTTCACCTTGCCAGGCCA
GCAATTTCCTGCGATCTTTCCGCACTGTGCCAGAGGCCTCGGCACTGGGA
TTGATTCTCACCGACCGCTCATCGAACGTCAATCTAATATCGCTGATACA
GAACTGGAACCGATTCATTTTGCATCAAATGCATTACGAAATATTCGATT
CTAGCAAGAACGCATCCACCTACAGCGGATCTGTGCAAACATCAACGAAC
GCGGAAAACGCGGGCTCTTCAGAAACAAGTGGCTCCTCGGACCTTTACGA
TTCCATAAGTGATGAGAACTCCAAGGAGGACGATCGGGAACGCAGTAAGA
TCAACGCAGAAACTGACATCAGTAAGATCTTTGGGACCAAGCAAATCTGT
ATAAACCGCTGCATCAAATGCCAAGAAGAGAAGATAAAGGAAAGCATTCT
ACTTGCCTGCAATTTGTCGTATCCCAACCACATCAAAGATAGTGATCAGT
ATTTCAACTTTGGCACCATTTTGAAGCGATCTCTCAGCTCCGAGAAGAGT
ATTCAGGCCTTCTGCGAGAGATGTAAGAAGTTTTCGCCAACCAATCAGAG
CGTGAAGGTGACTTCGCTTCCGCAAATTCTGTCCATTAACTGTGGCCTCA
ACAACGAAAAAGACATTACCTTCCTGAAGCGCCAGCTCAATCGCTGCAGC
GAAAAGACGACTGTTGATGCGGCCGCTTCCTTGAGCACAAGCAAGCCGTG
TCGATATGGAGCCAACTGTTCGCGAAGTGACTGCCATTTCATGCATCCGG
ATCGAAAATCTCCATCGCACACAAGCCAACCGAATGCTGTCAACAATTCT
CCCAATGGACGCCAAAAGTCCTGGTTTCCCCTTACATTTACTATGGGCAT
CAATGACCAAGGTGAGGTGCAGGTGCAAACTCAATCAGATGCAAGCAGTG
GCAAATCGGAACAGGAGGAGGAAACGGAAAAGCCACCAACAAAGGGCTTG
GACAACAATCGGATGTACGCGCTGCATGCCGTGGTGTGCCAAGTCGATGA
TGGTACCCAAAAGAACTTGGTATCGTTGATAAATGTGCAGCGGCCATACC
ACACCATGAAACTGGCTGAATCTGCAGATGACCCTCAGAGTCAATGGTAT
ATTTTTAATGATTTTAGCATATCGCCCGTTTCGCCACAAGAATCGGTATG
GTTCACATTGGATTGGAAAGTTCCTTGCATACTCTTCTACAGACACGTAG
AGGATGACTCTGAGTCTGCTAGTACTACTAGCTCGACCGTCACGGAAAGT
GAAGAAACCATTCCATCAGAGAGCAGCAGCGGCTCGCCAACAAATCTATC
CAACCCTTTTCTAGAGGAAATTGTGAGTCCTATGCTAGGCAACTTAAGTG
CAGACGCCACGCTGCAGCCCCTGCAGTCAGATGAAATGCCGCAGTCGGGT
GATCTGGTCGCAATGGATGCCGAGTTCGTTACCCTAAATCCAGAGGAAAA
TGAGATTCGCCCGGATGGCAAAACGGCGACCATTAAGCCATGCCACATGA
GTGTGGCCCGGATTTCATGTATACGAGGACAAGGCCCGGCTGAAGGAGTT
CCATTCATGGACGATTACATATCCACCCAGGAGAAGGTCGTGGACTACCT
AACTCAGTTCTCGGGAATCAAGCCTGGCGACTTGGACGCTAACTTCAGCA
AAAAGCGACTGACTGCCTTGAAGTACTCATACCAGAAATTAAAATACCTC
GTTGACGTAGGAGTAATATTTGTCGGACATGGTCTGAAGAACGACTTTAG
GGTCATAAACATCTATGTACCGTCGGAGCAGATAATAGATACGGTGCACC
TGTTTCACATGCCACATCATCGCATGGTTTCCCTAAGATTTCTAGCCTGG
CATTTCTTGGGTACTAAGATTCAGTCCGAGACGCACGACTCCATCGAAGA
TGCACGGACCACTCTGCAGCTCTACAAGCACTATTTGAAGCTGCAGGAGG
AGAAGAAGTTTGCCAACGCTCTCAAGAATCTTTACGAACGCGGAAAGCAG
CTGCAGTGGAAGGTTCCAGAGGACTGATTCGTCGCCAAACCCGATGCCAA
TTCGACGAAACTCATAATCAACGTTATCGTCAGTACAAACGCTACACCGA
TCTGAAAAAATCCCGGCTTCTCCCAATTTTATTATGTTTTAATGCGTTGC
TATTTGCTACGAAGCTCCTGGTATTTCATGTTGTATTTGTCTATCTTTAT
AACAAAATCAAAACAAAGCATAAAAAAAAAAAAAAAAAAAAAAAAAA

LP04771.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:35:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG8232-RA 4379 CG8232-RA 83..4107 1..4025 20125 100 Plus
CG8232.c 4308 CG8232.c 50..4071 1..4025 20055 99.9 Plus
CG8232.b 4225 CG8232.b 342..4210 157..4025 19345 100 Plus
CG8232.b 4225 CG8232.b 83..241 1..159 795 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:52:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4816487..4817748 518..1779 6295 99.9 Plus
chr2R 21145070 chr2R 4818881..4819244 2554..2917 1820 100 Plus
chr2R 21145070 chr2R 4820293..4820654 3660..4021 1810 100 Plus
chr2R 21145070 chr2R 4818260..4818558 2061..2359 1495 100 Plus
chr2R 21145070 chr2R 4819841..4820064 3328..3551 1120 100 Plus
chr2R 21145070 chr2R 4819564..4819777 3115..3328 1070 100 Plus
chr2R 21145070 chr2R 4819304..4819505 2916..3117 1010 100 Plus
chr2R 21145070 chr2R 4818619..4818817 2356..2554 995 100 Plus
chr2R 21145070 chr2R 4816009..4816200 157..348 960 100 Plus
chr2R 21145070 chr2R 4816260..4816429 348..517 850 100 Plus
chr2R 21145070 chr2R 4815750..4815908 1..159 795 100 Plus
chr2R 21145070 chr2R 4817809..4817931 1779..1901 615 100 Plus
chr2R 21145070 chr2R 4820120..4820233 3549..3662 570 100 Plus
chr2R 21145070 chr2R 4817982..4818084 1899..2001 515 100 Plus
chr2R 21145070 chr2R 4818141..4818201 2001..2061 305 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:52:39
Subject Length Description Subject Range Query Range Score Percent Strand
PAN2-RA 3726 CG8232-PA 1..3726 102..3827 18630 100 Plus
PAN2-RB 3723 CG8232-PB 1..3723 102..3827 18550 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:49:32 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:52:37
Subject Length Description Subject Range Query Range Score Percent Strand
PAN2-RA 4051 CG8232-RA 31..4051 1..4021 20105 100 Plus
PAN2-RB 4048 CG8232-RB 31..4048 1..4021 20025 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:52:43
Subject Length Description Subject Range Query Range Score Percent Strand
PAN2-PA 1241 CG8232-PA 1..1241 102..3824 6228 100 Plus
PAN2-PB 1240 CG8232-PB 1..1240 102..3824 6207 99.8 Plus
CG6833-PB 290 CG6833-PB 136..269 3303..3725 173 33.3 Plus
CG6833-PA 290 CG6833-PA 136..269 3303..3725 173 33.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:52:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8928936..8930197 518..1779 6310 100 Plus
2R 25286936 2R 8932742..8933107 3660..4025 1830 100 Plus
2R 25286936 2R 8931330..8931693 2554..2917 1820 100 Plus
2R 25286936 2R 8930709..8931007 2061..2359 1495 100 Plus
2R 25286936 2R 8932290..8932513 3328..3551 1120 100 Plus
2R 25286936 2R 8932013..8932226 3115..3328 1070 100 Plus
2R 25286936 2R 8931753..8931954 2916..3117 1010 100 Plus
2R 25286936 2R 8931068..8931266 2356..2554 995 100 Plus
2R 25286936 2R 8928458..8928649 157..348 960 100 Plus
2R 25286936 2R 8928709..8928878 348..517 850 100 Plus
2R 25286936 2R 8928199..8928357 1..159 795 100 Plus
2R 25286936 2R 8930258..8930380 1779..1901 615 100 Plus
2R 25286936 2R 8932569..8932682 3549..3662 570 100 Plus
2R 25286936 2R 8930431..8930533 1899..2001 515 100 Plus
2R 25286936 2R 8930590..8930650 2001..2061 305 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:32:14
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8930135..8931396 518..1779 6310 100 Plus
2R 25260384 2R 8933941..8934306 3660..4025 1830 100 Plus
2R 25260384 2R 8932529..8932892 2554..2917 1820 100 Plus
2R 25260384 2R 8931908..8932206 2061..2359 1495 100 Plus
2R 25260384 2R 8933489..8933712 3328..3551 1120 100 Plus
2R 25260384 2R 8933212..8933425 3115..3328 1070 100 Plus
2R 25260384 2R 8932952..8933153 2916..3117 1010 100 Plus
2R 25260384 2R 8932267..8932465 2356..2554 995 100 Plus
2R 25260384 2R 8929657..8929848 157..348 960 100 Plus
2R 25260384 2R 8929908..8930077 348..517 850 100 Plus
2R 25260384 2R 8929398..8929556 1..159 795 100 Plus
2R 25260384 2R 8931457..8931579 1779..1901 615 100 Plus
2R 25260384 2R 8933768..8933881 3549..3662 570 100 Plus
2R 25260384 2R 8931630..8931732 1899..2001 515 100 Plus
2R 25260384 2R 8931789..8931849 2001..2061 305 100 Plus
Blast to na_te.dros performed on 2014-11-26 19:52:35 has no hits.

LP04771.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:39:55 Download gff for LP04771.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4820294..4820654 3661..4021 100   Plus
chr2R 4820122..4820231 3551..3660 100 -> Plus
chr2R 4819842..4820063 3329..3550 100 -> Plus
chr2R 4819566..4819777 3117..3328 100 -> Plus
chr2R 4819306..4819504 2918..3116 100 -> Plus
chr2R 4818882..4819244 2555..2917 100 -> Plus
chr2R 4818621..4818817 2358..2554 100 -> Plus
chr2R 4818261..4818556 2062..2357 100 -> Plus
chr2R 4818142..4818201 2002..2061 100 -> Plus
chr2R 4817985..4818084 1902..2001 100 -> Plus
chr2R 4817810..4817931 1780..1901 100 -> Plus
chr2R 4816487..4817748 518..1779 99 -> Plus
chr2R 4816260..4816429 348..517 100 -> Plus
chr2R 4816009..4816199 157..347 100 -> Plus
chr2R 4815750..4815905 1..156 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:35:59 Download gff for LP04771.complete
Subject Subject Range Query Range Percent Splice Strand
CG8232-RA 1..3726 102..3827 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:05:23 Download gff for LP04771.complete
Subject Subject Range Query Range Percent Splice Strand
CG8232-RA 1..3726 102..3827 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:38:42 Download gff for LP04771.complete
Subject Subject Range Query Range Percent Splice Strand
CG8232-RA 1..3726 102..3827 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:51:42 Download gff for LP04771.complete
Subject Subject Range Query Range Percent Splice Strand
CG8232-RA 1..3726 102..3827 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:39:55 Download gff for LP04771.complete
Subject Subject Range Query Range Percent Splice Strand
PAN2-RA 1..3726 102..3827 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:58:40 Download gff for LP04771.complete
Subject Subject Range Query Range Percent Splice Strand
CG8232-RA 26..4039 1..4014 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:05:23 Download gff for LP04771.complete
Subject Subject Range Query Range Percent Splice Strand
CG8232-RA 26..4046 1..4021 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:38:42 Download gff for LP04771.complete
Subject Subject Range Query Range Percent Splice Strand
CG8232-RA 31..4051 1..4021 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:51:42 Download gff for LP04771.complete
Subject Subject Range Query Range Percent Splice Strand
CG8232-RA 26..4039 1..4014 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:39:55 Download gff for LP04771.complete
Subject Subject Range Query Range Percent Splice Strand
PAN2-RA 31..4051 1..4021 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:39:55 Download gff for LP04771.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8932743..8933103 3661..4021 100   Plus
2R 8932571..8932680 3551..3660 100 -> Plus
2R 8932291..8932512 3329..3550 100 -> Plus
2R 8932015..8932226 3117..3328 100 -> Plus
2R 8931755..8931953 2918..3116 100 -> Plus
2R 8931331..8931693 2555..2917 100 -> Plus
2R 8931070..8931266 2358..2554 100 -> Plus
2R 8930710..8931005 2062..2357 100 -> Plus
2R 8930591..8930650 2002..2061 100 -> Plus
2R 8930434..8930533 1902..2001 100 -> Plus
2R 8930259..8930380 1780..1901 100 -> Plus
2R 8928936..8930197 518..1779 100 -> Plus
2R 8928709..8928878 348..517 100 -> Plus
2R 8928458..8928648 157..347 100 -> Plus
2R 8928199..8928354 1..156 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:38:42 Download gff for LP04771.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4820248..4820608 3661..4021 100   Plus
arm_2R 4820076..4820185 3551..3660 100 -> Plus
arm_2R 4819796..4820017 3329..3550 100 -> Plus
arm_2R 4819520..4819731 3117..3328 100 -> Plus
arm_2R 4819260..4819458 2918..3116 100 -> Plus
arm_2R 4818836..4819198 2555..2917 100 -> Plus
arm_2R 4818575..4818771 2358..2554 100 -> Plus
arm_2R 4818215..4818510 2062..2357 100 -> Plus
arm_2R 4818096..4818155 2002..2061 100 -> Plus
arm_2R 4817939..4818038 1902..2001 100 -> Plus
arm_2R 4817764..4817885 1780..1901 100 -> Plus
arm_2R 4816441..4817702 518..1779 100 -> Plus
arm_2R 4816214..4816383 348..517 100 -> Plus
arm_2R 4815963..4816153 157..347 100 -> Plus
arm_2R 4815704..4815859 1..156 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:57:33 Download gff for LP04771.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8933942..8934302 3661..4021 100   Plus
2R 8933770..8933879 3551..3660 100 -> Plus
2R 8933490..8933711 3329..3550 100 -> Plus
2R 8933214..8933425 3117..3328 100 -> Plus
2R 8932954..8933152 2918..3116 100 -> Plus
2R 8932530..8932892 2555..2917 100 -> Plus
2R 8932269..8932465 2358..2554 100 -> Plus
2R 8931909..8932204 2062..2357 100 -> Plus
2R 8931790..8931849 2002..2061 100 -> Plus
2R 8931633..8931732 1902..2001 100 -> Plus
2R 8931458..8931579 1780..1901 100 -> Plus
2R 8930135..8931396 518..1779 100 -> Plus
2R 8929908..8930077 348..517 100 -> Plus
2R 8929657..8929847 157..347 100 -> Plus
2R 8929398..8929553 1..156 100 -> Plus

LP04771.pep Sequence

Translation from 101 to 3826

> LP04771.pep
MDYVYCGTDPIGASEDILSVYDAGSAPGNGHFSPSFNGFNIGTTDPEYVE
LVPVLADGGEHFGVSSVAFDDYEELLWMGNQGGHVTSYYTNSMQKYTSFQ
VHATDIVRDISTLDSGVLALTQTSLRHQIRRGLPKFTFKSNNMKEMVSML
QLSPHRLVMAGLQDELIDFDLRTLKETRIEHVGAGGCTVLRKNSRYLFAG
DQLGTVTLRDLNSLSVQHTIKTHTNILSDFSVQGNLLISCGYSGRQNNLA
IDRFLMVYDLRMLRLIAPIQVMIDPQMLKFLPSLTSQLAVVSSYGQVQLV
DTVELSEPRVSMYQINTNGSQCLSFDISSSSQAMAFGDQSGHINMIAAVQ
TPQPQFNLYSRSTEFADVVPQLPMVSITDTNFPLSSVMLPHLTTGTQWFS
DWPEELLRYRYHRPKTIDPEVLSNMKMQGPIGYSPNPRTARRNQIPYVIE
QGGVCSPNGNGTAAATKAENGVKIIPRRYRKVELKYTKLGTQDFDFDQHN
QTCFAGLEATLPNSYCNAMLQILYFTDALRVKLLEHSCIKEFCLSCELGF
LFNMLDKSTASSPCQASNFLRSFRTVPEASALGLILTDRSSNVNLISLIQ
NWNRFILHQMHYEIFDSSKNASTYSGSVQTSTNAENAGSSETSGSSDLYD
SISDENSKEDDRERSKINAETDISKIFGTKQICINRCIKCQEEKIKESIL
LACNLSYPNHIKDSDQYFNFGTILKRSLSSEKSIQAFCERCKKFSPTNQS
VKVTSLPQILSINCGLNNEKDITFLKRQLNRCSEKTTVDAAASLSTSKPC
RYGANCSRSDCHFMHPDRKSPSHTSQPNAVNNSPNGRQKSWFPLTFTMGI
NDQGEVQVQTQSDASSGKSEQEEETEKPPTKGLDNNRMYALHAVVCQVDD
GTQKNLVSLINVQRPYHTMKLAESADDPQSQWYIFNDFSISPVSPQESVW
FTLDWKVPCILFYRHVEDDSESASTTSSTVTESEETIPSESSSGSPTNLS
NPFLEEIVSPMLGNLSADATLQPLQSDEMPQSGDLVAMDAEFVTLNPEEN
EIRPDGKTATIKPCHMSVARISCIRGQGPAEGVPFMDDYISTQEKVVDYL
TQFSGIKPGDLDANFSKKRLTALKYSYQKLKYLVDVGVIFVGHGLKNDFR
VINIYVPSEQIIDTVHLFHMPHHRMVSLRFLAWHFLGTKIQSETHDSIED
ARTTLQLYKHYLKLQEEKKFANALKNLYERGKQLQWKVPED*

LP04771.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 20:27:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12217-PA 1246 GF12217-PA 1..1246 1..1241 5795 86 Plus
Dana\GF24592-PA 305 GF24592-PA 128..284 1031..1208 182 31 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 20:27:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23399-PA 1240 GG23399-PA 1..1240 1..1241 6404 95 Plus
Dere\GG15670-PA 289 GG15670-PA 135..269 1068..1209 166 33.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 20:27:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23112-PA 1242 GH23112-PA 1..1242 1..1241 5379 79.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 20:27:42
Subject Length Description Subject Range Query Range Score Percent Strand
PAN2-PA 1241 CG8232-PA 1..1241 1..1241 6484 100 Plus
PAN2-PB 1240 CG8232-PB 1..1240 1..1241 6463 99.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 20:27:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18935-PA 1238 GI18935-PA 1..1238 1..1241 5384 80.1 Plus
Dmoj\GI13758-PA 275 GI13758-PA 127..260 1068..1208 162 32.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 20:27:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11682-PA 736 GL11682-PA 190..736 694..1241 2351 82.7 Plus
Dper\GL11682-PA 736 GL11682-PA 1..139 1..140 673 87.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 20:27:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20915-PA 1237 GA20915-PA 1..1237 1..1241 5675 85.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 20:27:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21079-PA 1241 GM21079-PA 1..1241 1..1241 6611 98.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 20:27:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21307-PA 1248 GJ21307-PA 1..1248 1..1241 5389 80 Plus
Dvir\GJ13749-PA 275 GJ13749-PA 124..257 1068..1208 177 32.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 20:28:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10644-PA 1242 GK10644-PA 1..1242 1..1241 5588 83.1 Plus
Dwil\GK17035-PA 297 GK17035-PA 135..268 1068..1208 183 34 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 20:28:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19240-PA 1241 GE19240-PA 1..1241 1..1241 6347 94.9 Plus
Dyak\GE21999-PA 289 GE21999-PA 135..268 1068..1208 166 34 Plus

LP04771.hyp Sequence

Translation from 101 to 3826

> LP04771.hyp
MDYVYCGTDPIGASEDILSVYDAGSAPGNGHFSPSFNGFNIGTTDPEYVE
LVPVLADGGEHFGVSSVAFDDYEELLWMGNQGGHVTSYYTNSMQKYTSFQ
VHATDIVRDISTLDSGVLALTQTSLRHQIRRGLPKFTFKSNNMKEMVSML
QLSPHRLVMAGLQDELIDFDLRTLKETRIEHVGAGGCTVLRKNSRYLFAG
DQLGTVTLRDLNSLSVQHTIKTHTNILSDFSVQGNLLISCGYSGRQNNLA
IDRFLMVYDLRMLRLIAPIQVMIDPQMLKFLPSLTSQLAVVSSYGQVQLV
DTVELSEPRVSMYQINTNGSQCLSFDISSSSQAMAFGDQSGHINMIAAVQ
TPQPQFNLYSRSTEFADVVPQLPMVSITDTNFPLSSVMLPHLTTGTQWFS
DWPEELLRYRYHRPKTIDPEVLSNMKMQGPIGYSPNPRTARRNQIPYVIE
QGGVCSPNGNGTAAATKAENGVKIIPRRYRKVELKYTKLGTQDFDFDQHN
QTCFAGLEATLPNSYCNAMLQILYFTDALRVKLLEHSCIKEFCLSCELGF
LFNMLDKSTASSPCQASNFLRSFRTVPEASALGLILTDRSSNVNLISLIQ
NWNRFILHQMHYEIFDSSKNASTYSGSVQTSTNAENAGSSETSGSSDLYD
SISDENSKEDDRERSKINAETDISKIFGTKQICINRCIKCQEEKIKESIL
LACNLSYPNHIKDSDQYFNFGTILKRSLSSEKSIQAFCERCKKFSPTNQS
VKVTSLPQILSINCGLNNEKDITFLKRQLNRCSEKTTVDAAASLSTSKPC
RYGANCSRSDCHFMHPDRKSPSHTSQPNAVNNSPNGRQKSWFPLTFTMGI
NDQGEVQVQTQSDASSGKSEQEEETEKPPTKGLDNNRMYALHAVVCQVDD
GTQKNLVSLINVQRPYHTMKLAESADDPQSQWYIFNDFSISPVSPQESVW
FTLDWKVPCILFYRHVEDDSESASTTSSTVTESEETIPSESSSGSPTNLS
NPFLEEIVSPMLGNLSADATLQPLQSDEMPQSGDLVAMDAEFVTLNPEEN
EIRPDGKTATIKPCHMSVARISCIRGQGPAEGVPFMDDYISTQEKVVDYL
TQFSGIKPGDLDANFSKKRLTALKYSYQKLKYLVDVGVIFVGHGLKNDFR
VINIYVPSEQIIDTVHLFHMPHHRMVSLRFLAWHFLGTKIQSETHDSIED
ARTTLQLYKHYLKLQEEKKFANALKNLYERGKQLQWKVPED*

LP04771.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:56:31
Subject Length Description Subject Range Query Range Score Percent Strand
PAN2-PA 1241 CG8232-PA 1..1241 1..1241 6484 100 Plus
PAN2-PB 1240 CG8232-PB 1..1240 1..1241 6463 99.8 Plus