Clone LP06390 Report

Search the DGRC for LP06390

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:63
Well:90
Vector:pOT2
Associated Gene/TranscriptImpL1-RA
Protein status:LP06390.pep: gold
Sequenced Size:1153

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
ImpL1-RA 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

LP06390.complete Sequence

1153 bp assembled on 2011-01-11

GenBank Submission: BT125907.1

> LP06390.complete
CAGCTGACCAGATCAACATGAGGCCATACCAAGTAGTTTGCATCGTAGCA
GTAGCAGCTCTGCTGCTTTTGGAGGCGATTCCCGCGGATGCAAAGCGGCG
CAAGCACAAGGGCTCCGATCATCACTATGAAAAGTCTGATCCCCACAAGA
CCAAGACAAAGACCAAGTGGTCTAGCTCCACGGATTTGGCTGGAAACACT
CCAATTTCCACCGAAGAGCACGGCTACTATGTAAAGCGCACCTTTGCGGC
TCCCGGTGAGATTGGAGCCGCACAGAAGCGTCTAAGTCCCCCCTATTTGG
CCATTCCCATCGCCTGGTTCAGCTGTGAGTCGGGCCAGAAGAATTGCCAG
TCTTCCAATTCCGCGGCTATCAACAGTGCCGCGCAGTCCTTGAGCGAGGG
CTATCTGTGCGACGATGATTGCGATGAACTGTACGAGCCCATCTGCGGCA
GGACCACCTCAGAGGTGGCCGTTTTCTACAACAAGTGCAAGTTGGGTGTA
GCCAAGTGCCGATCCCACGGTCTTTGGACGGACTTCGCCTATGCCGAGTG
CCAGGCGAAATATCCGCAGGAAACTGCCTATGCCGACAAGAAGTTCCGGT
CATCGCCTTATTTCCGGGATGCGGCCATCGTGGAGCAATTGAAGCTGGAG
GAGGAGAAGCGTAAGCAGGAGGAGGAACAACACAAGCTGGAGAAGGAGCA
AAAGAAGAAGGAGAAGGCTGAGAAAAATAAGAACGAGAAGGACAGCAGCG
AAAGCAGCGAGGAGAAGGATGACCAAAAGGAAAACAAGCAGAAGGATCCC
CTTTCCCTAATGCCACAGAAGAAAGTGGAATCCACCCAGAAGCCAGTGCC
AGTTCCTATTCAAGTAGCAGTTCCAAAACCAGTTTCAGTTTTGGAGCCTG
CAAAGACGACCGAGGACATCGCTATGCCGCCTATGCCACTGAAGGACACT
CCCACGCCCAAACCTCTGGAGATCGCGCCCCTTCACCAGCAGACCCAACC
CAAGGGCAAGGACATTGATAGGCTCAAGTACCAAGTAGCTTAGAAAGCAA
TGGCTACACAAATCTCACCTAATTATAGTATTTATTTAATTTATTACAAC
AAATAAAATTCTAAACAACGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAA

LP06390.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:53:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 13373135..13374209 46..1120 5375 100 Plus
chr3L 24539361 chr3L 13373015..13373062 1..48 240 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:53:19
Subject Length Description Subject Range Query Range Score Percent Strand
ImpL1-RA 1026 CG10717-PA 1..1026 18..1043 5130 100 Plus
ImpL1-RC 1023 CG10717-PC 1..1023 18..1043 5050 99.7 Plus
ImpL1-RB 1101 CG10717-PB 104..1101 46..1043 4990 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:53:17
Subject Length Description Subject Range Query Range Score Percent Strand
ImpL1-RA 1160 CG10717-RA 24..1143 1..1120 5600 100 Plus
ImpL1-RC 1157 CG10717-RC 24..1140 1..1120 5520 99.7 Plus
ImpL1-RB 1230 CG10717-RB 139..1213 46..1120 5375 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:53:22
Subject Length Description Subject Range Query Range Score Percent Strand
ImpL1-PA 341 CG10717-PA 1..341 18..1040 1230 100 Plus
ImpL1-PC 340 CG10717-PC 1..340 18..1040 1219 98.2 Plus
ImpL1-PB 366 CG10717-PB 46..366 78..1040 1216 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:53:15
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13382908..13383983 46..1121 5380 100 Plus
3L 28110227 3L 13382788..13382835 1..48 240 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:05:18
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 13376008..13377083 46..1121 5380 100 Plus
3L 28103327 3L 13375888..13375935 1..48 240 100 Plus
Blast to na_te.dros performed 2014-11-27 16:53:16
Subject Length Description Subject Range Query Range Score Percent Strand
TART-C 11124 TART-C TARTC 11124bp 8767..8891 642..760 117 56.8 Plus
gypsy9 5349 gypsy9 GYPSY9 5349bp 728..782 1108..1054 112 71.4 Minus

LP06390.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 18:00:03 Download gff for LP06390.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 13373886..13374209 797..1120 100   Plus
chr3L 13373138..13373735 49..646 100 == Plus
chr3L 13373015..13373062 1..48 100 -> Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-01-11 10:26:33 Download gff for LP06390.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL1-RA 1..1026 18..1043 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:40:52 Download gff for LP06390.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL1-RA 1..1026 18..1043 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 18:00:03 Download gff for LP06390.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL1-RA 1..1026 18..1043 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-11 10:26:32 Download gff for LP06390.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL1-RA 32..1151 1..1120 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:40:52 Download gff for LP06390.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL1-RA 24..1143 1..1120 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 18:00:03 Download gff for LP06390.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL1-RA 24..1143 1..1120 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 18:00:03 Download gff for LP06390.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13382911..13383982 49..1120 100   Plus
3L 13382788..13382835 1..48 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:40:52 Download gff for LP06390.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13376011..13377082 49..1120 100   Plus
arm_3L 13375888..13375935 1..48 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:55:08 Download gff for LP06390.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13376011..13377082 49..1120 100   Plus
3L 13375888..13375935 1..48 100 -> Plus

LP06390.pep Sequence

Translation from 2 to 1042

> LP06390.pep
ADQINMRPYQVVCIVAVAALLLLEAIPADAKRRKHKGSDHHYEKSDPHKT
KTKTKWSSSTDLAGNTPISTEEHGYYVKRTFAAPGEIGAAQKRLSPPYLA
IPIAWFSCESGQKNCQSSNSAAINSAAQSLSEGYLCDDDCDELYEPICGR
TTSEVAVFYNKCKLGVAKCRSHGLWTDFAYAECQAKYPQETAYADKKFRS
SPYFRDAAIVEQLKLEEEKRKQEEEQHKLEKEQKKKEKAEKNKNEKDSSE
SSEEKDDQKENKQKDPLSLMPQKKVESTQKPVPVPIQVAVPKPVSVLEPA
KTTEDIAMPPMPLKDTPTPKPLEIAPLHQQTQPKGKDIDRLKYQVA*

LP06390.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:32:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24041-PA 356 GF24041-PA 1..356 6..346 880 65.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:32:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15638-PA 343 GG15638-PA 1..343 6..346 1356 88.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:32:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17161-PA 320 GH17161-PA 1..278 6..319 755 51.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:32:24
Subject Length Description Subject Range Query Range Score Percent Strand
ImpL1-PA 341 CG10717-PA 1..341 6..346 1797 100 Plus
ImpL1-PC 340 CG10717-PC 1..340 6..346 1781 99.7 Plus
ImpL1-PB 366 CG10717-PB 1..366 6..346 1761 93.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:32:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11776-PA 362 GI11776-PA 1..292 6..316 685 51.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:32:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15712-PA 323 GL15712-PA 44..323 48..346 848 59.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:32:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10517-PA 323 GA10517-PA 18..323 24..346 875 60.1 Plus
Dpse\GA29257-PA 304 GA29257-PA 18..196 24..213 652 69.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:32:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25416-PA 342 GM25416-PA 1..342 6..346 1400 94.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:32:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14446-PA 342 GD14446-PA 1..342 6..346 1394 94.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:32:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13478-PA 333 GJ13478-PA 1..277 6..314 745 54.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:32:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17441-PA 324 GK17441-PA 1..277 6..325 664 50.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:32:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21966-PA 348 GE21966-PA 1..348 6..346 1420 90.5 Plus

LP06390.hyp Sequence

Translation from 2 to 1042

> LP06390.hyp
ADQINMRPYQVVCIVAVAALLLLEAIPADAKRRKHKGSDHHYEKSDPHKT
KTKTKWSSSTDLAGNTPISTEEHGYYVKRTFAAPGEIGAAQKRLSPPYLA
IPIAWFSCESGQKNCQSSNSAAINSAAQSLSEGYLCDDDCDELYEPICGR
TTSEVAVFYNKCKLGVAKCRSHGLWTDFAYAECQAKYPQETAYADKKFRS
SPYFRDAAIVEQLKLEEEKRKQEEEQHKLEKEQKKKEKAEKNKNEKDSSE
SSEEKDDQKENKQKDPLSLMPQKKVESTQKPVPVPIQVAVPKPVSVLEPA
KTTEDIAMPPMPLKDTPTPKPLEIAPLHQQTQPKGKDIDRLKYQVA*

LP06390.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:16:55
Subject Length Description Subject Range Query Range Score Percent Strand
ImpL1-PA 341 CG10717-PA 1..341 6..346 1797 100 Plus
ImpL1-PC 340 CG10717-PC 1..340 6..346 1781 99.7 Plus
ImpL1-PB 366 CG10717-PB 1..366 6..346 1761 93.2 Plus