Clone LP07209 Report

Search the DGRC for LP07209

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:72
Well:9
Vector:pOT2
Associated Gene/TranscriptCG1792-RA
Protein status:LP07209.pep: gold
Preliminary Size:1181
Sequenced Size:1324

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1792 2002-01-01 Sim4 clustering to Release 2
CG1792 2002-05-18 Blastp of sequenced clone
CG1792 2003-01-01 Sim4 clustering to Release 3
CG1792 2008-04-29 Release 5.5 accounting
CG1792 2008-08-15 Release 5.9 accounting
CG1792 2008-12-18 5.12 accounting

Clone Sequence Records

LP07209.complete Sequence

1324 bp (1324 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119056

> LP07209.complete
AAAAGCAGAGCAATTTTCTGATTAATTTTTTCTTAAGTGTTACTAAATAA
ATAAGTTTAAAAATGCCGAATCGTAATTGCCGGACTTGCGGCCTGTTCAT
TTTCTGTTCGACGCCCAGTAACCTCTTCGAGGAGCCCAATTCCGTAATGC
TGCACCAGATCGAGGTTCTTACTGGTTTGTTTTTGCTCGGCGGACCCGGG
AACGAGCTGCCCCCCTTTATTTGCTCACCCTGCGAATTGGACCTGCAGAC
GGCGATTGCTTTCCGGGAACGTGTGATTCGAACCCAAAAAACGCTGCAGG
AAAGTCCCAACCTGGGGAACGCGGAATTGATCGAATCCTTCGCAGTTGGT
GTGGAGAAGGAGATTCAGTACGCTGAAGAGGTCACCGAGATCGAGGTTAT
AGACCTTCTACCCGAGGAACACCTGCTGGAAGAGACGGAAGAGCCGTACG
AAATATGTGAGCAGAACGAGCAGCCCCAAGTGAAGGTTCCTGCGCAGGAG
AAGAAGCTCCGCAGAAGTACAAAGACCACGCCCACAGTCTTTACCTCCGT
TAAGTTTGCGGACAATAGCCAGGCCACGCGCACCCAGTGGAGCAGACTCA
CCGAGGACGAAGTGGTGGCCCTAAAGCGGGAGCGACGCAAGCGGGATTGC
ATATGCGAGCAGTGTGGCCGGCACTTCACCTGCCCCAGCAACTTCAAGTT
GCACCTCCTCCGACACACCGGCGTAAAGAGCTTTGCCTGTGACCAGTGCT
CCCAGCAGTTCTACACTGCTACGCTTCTGCGGCGCCACCAAGAACTGCAT
GCGGGGAATGCTTTGTTTCAGTGTCGCTACTGCGAGGCAACCTACAGCAA
CGCCAGCGGACGCATCCAGCACGAACGCATGCGCCACACGAATGTCAAGC
CCTTCACGTGCAAGGAATGCAATAAAAGCTTTGCCATGAGCGGAAAACTC
CGCACGCACATGCTGAGTCACACCGGAGTGCGAGCGTTCCACTGCGACTC
CTGCCAAGTCTCCTTCGTTCGCCGCTCCCACCTGACCTCCCACTATCGCT
CAAAAGGTCACGCCCACACTTCAAGCGCCCAGGCGGCACTGGACAATCCT
GTGGAACTGGACGTGAAGGCCAGTAACGGCATGCAGACAGGGGCTAAGGA
TGAGGCTTTACTAGGAAAAAGTGGATCTTAGGATAAACTGTACTAAAAAT
CAATGGATCCCCGATCTGATATTCGGATTAATACTCAATGCACTTAATAT
TAATCGAAAATGGAATATGTTCAAATATGGCTGTGTTGAATAAAAACTGA
TTTTTTCAAAAAAAAAAAAAAAAA

LP07209.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:01:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG1792-RA 1381 CG1792-RA 38..1348 1..1311 6555 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 12:45:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 27438958..27439656 183..881 3450 99.6 Plus
chr3R 27901430 chr3R 27439905..27440220 992..1307 1580 100 Plus
chr3R 27901430 chr3R 27438723..27438904 1..182 865 98.4 Plus
chr3R 27901430 chr3R 27439732..27439842 881..991 555 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:45:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG1792-RA 1119 CG1792-PA 1..1119 63..1181 5595 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:51:39 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:45:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG1792-RA 1344 CG1792-RA 38..1344 1..1307 6535 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:45:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG1792-PA 372 CG1792-PA 1..372 63..1178 1852 100 Plus
ranshi-PA 346 CG9793-PA 1..346 63..1100 470 34.7 Plus
CG8159-PB 399 CG8159-PB 6..349 78..1124 466 32.7 Plus
CG18764-PA 409 CG18764-PA 204..395 465..1061 465 43.5 Plus
CG11762-PA 312 CG11762-PA 1..310 63..1082 411 28.9 Plus
CG18764-PA 409 CG18764-PA 5..75 78..296 167 52.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 12:45:03
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 31616575..31617273 183..881 3495 100 Plus
3R 32079331 3R 31617522..31617841 992..1311 1600 100 Plus
3R 32079331 3R 31616340..31616521 1..182 910 100 Plus
3R 32079331 3R 31617349..31617459 881..991 555 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:33:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 31357406..31358104 183..881 3495 100 Plus
3R 31820162 3R 31358353..31358672 992..1311 1600 100 Plus
3R 31820162 3R 31357171..31357352 1..182 910 100 Plus
3R 31820162 3R 31358180..31358290 881..991 555 100 Plus
Blast to na_te.dros performed on 2014-11-27 12:45:04 has no hits.

LP07209.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 13:54:23 Download gff for LP07209.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 27439905..27440220 992..1307 100   Plus
chr3R 27439732..27439842 881..991 100 -> Plus
chr3R 27438958..27439655 183..880 99 -> Plus
chr3R 27438723..27438904 1..182 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:37:58 Download gff for LP07209.complete
Subject Subject Range Query Range Percent Splice Strand
CG1792-RA 1..1119 63..1181 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:42:23 Download gff for LP07209.complete
Subject Subject Range Query Range Percent Splice Strand
CG1792-RA 1..1119 63..1181 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:28:16 Download gff for LP07209.complete
Subject Subject Range Query Range Percent Splice Strand
CG1792-RA 1..1119 63..1181 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:34:32 Download gff for LP07209.complete
Subject Subject Range Query Range Percent Splice Strand
CG1792-RA 1..1119 63..1181 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:54:23 Download gff for LP07209.complete
Subject Subject Range Query Range Percent Splice Strand
CG1792-RA 1..1119 63..1181 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:16:43 Download gff for LP07209.complete
Subject Subject Range Query Range Percent Splice Strand
CG1792-RA 1..1307 1..1307 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:42:23 Download gff for LP07209.complete
Subject Subject Range Query Range Percent Splice Strand
CG1792-RA 37..1343 1..1307 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:28:16 Download gff for LP07209.complete
Subject Subject Range Query Range Percent Splice Strand
CG1792-RA 38..1344 1..1307 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:34:33 Download gff for LP07209.complete
Subject Subject Range Query Range Percent Splice Strand
CG1792-RA 1..1307 1..1307 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:54:23 Download gff for LP07209.complete
Subject Subject Range Query Range Percent Splice Strand
CG1792-RA 38..1344 1..1307 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 13:54:23 Download gff for LP07209.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31617522..31617837 992..1307 100   Plus
3R 31617349..31617459 881..991 100 -> Plus
3R 31616575..31617272 183..880 100 -> Plus
3R 31616340..31616521 1..182 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:28:16 Download gff for LP07209.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 27443244..27443559 992..1307 100   Plus
arm_3R 27443071..27443181 881..991 100 -> Plus
arm_3R 27442297..27442994 183..880 100 -> Plus
arm_3R 27442062..27442243 1..182 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:06:51 Download gff for LP07209.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31358353..31358668 992..1307 100   Plus
3R 31358180..31358290 881..991 100 -> Plus
3R 31357406..31358103 183..880 100 -> Plus
3R 31357171..31357352 1..182 100 -> Plus

LP07209.pep Sequence

Translation from 62 to 1180

> LP07209.pep
MPNRNCRTCGLFIFCSTPSNLFEEPNSVMLHQIEVLTGLFLLGGPGNELP
PFICSPCELDLQTAIAFRERVIRTQKTLQESPNLGNAELIESFAVGVEKE
IQYAEEVTEIEVIDLLPEEHLLEETEEPYEICEQNEQPQVKVPAQEKKLR
RSTKTTPTVFTSVKFADNSQATRTQWSRLTEDEVVALKRERRKRDCICEQ
CGRHFTCPSNFKLHLLRHTGVKSFACDQCSQQFYTATLLRRHQELHAGNA
LFQCRYCEATYSNASGRIQHERMRHTNVKPFTCKECNKSFAMSGKLRTHM
LSHTGVRAFHCDSCQVSFVRRSHLTSHYRSKGHAHTSSAQAALDNPVELD
VKASNGMQTGAKDEALLGKSGS*

LP07209.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 22:37:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22975-PA 367 GF22975-PA 2..354 3..352 1027 55.2 Plus
Dana\GF17452-PA 372 GF17452-PA 5..362 6..354 480 34.4 Plus
Dana\GF18383-PA 412 GF18383-PA 240..412 176..350 463 48.9 Plus
Dana\GF18186-PA 409 GF18186-PA 6..339 6..335 461 33.9 Plus
Dana\GF18185-PA 317 GF18185-PA 6..310 6..333 444 32.5 Plus
Dana\GF18383-PA 412 GF18383-PA 5..77 6..80 167 46.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 22:37:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11820-PA 361 GG11820-PA 1..360 1..354 1496 78.4 Plus
Dere\GG18288-PA 425 GG18288-PA 254..412 176..334 444 49.4 Plus
Dere\GG12626-PA 304 GG12626-PA 1..292 1..333 428 32.9 Plus
Dere\GG17430-PA 347 GG17430-PA 1..343 1..347 426 32.6 Plus
Dere\GG12737-PA 394 GG12737-PA 193..330 197..335 375 48.2 Plus
Dere\GG18288-PA 425 GG18288-PA 5..75 6..78 173 49.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 22:37:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18643-PA 383 GH18643-PA 5..379 6..352 843 45.2 Plus
Dgri\GH18577-PA 386 GH18577-PA 1..347 1..344 414 32.7 Plus
Dgri\GH18112-PA 426 GH18112-PA 254..418 170..334 410 48.8 Plus
Dgri\GH18576-PA 371 GH18576-PA 2..353 6..333 393 31 Plus
Dgri\GH19018-PA 716 GH19018-PA 349..702 7..333 391 31.1 Plus
Dgri\GH18112-PA 426 GH18112-PA 5..328 6..329 176 25.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 22:37:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG1792-PA 372 CG1792-PA 1..372 1..372 1974 100 Plus
ranshi-PA 346 CG9793-PA 1..346 1..346 485 34.7 Plus
CG8159-PB 399 CG8159-PB 6..349 6..354 476 34.2 Plus
CG18764-PA 409 CG18764-PA 159..395 90..333 476 39.1 Plus
CG11762-PA 312 CG11762-PA 1..310 1..340 421 29.5 Plus
CG18764-PA 409 CG18764-PA 5..340 6..334 203 26.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 22:37:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23401-PA 372 GI23401-PA 5..369 6..353 859 48.4 Plus
Dmoj\GI24613-PA 425 GI24613-PA 251..409 176..334 469 50 Plus
Dmoj\GI22394-PA 371 GI22394-PA 6..355 6..357 462 33.3 Plus
Dmoj\GI22983-PA 389 GI22983-PA 4..371 6..345 446 30.4 Plus
Dmoj\GI22393-PA 359 GI22393-PA 6..348 6..340 433 32.8 Plus
Dmoj\GI24613-PA 425 GI24613-PA 5..320 6..330 180 24.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 22:37:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23638-PA 343 GL23638-PA 1..339 29..352 877 52.9 Plus
Dper\GL22114-PA 400 GL22114-PA 204..390 143..333 466 45.3 Plus
Dper\GL12476-PA 333 GL12476-PA 6..327 6..340 427 32.7 Plus
Dper\GL12614-PA 349 GL12614-PA 5..331 6..333 412 32.4 Plus
Dper\GL12613-PA 364 GL12613-PA 5..360 6..354 391 30.4 Plus
Dper\GL22114-PA 400 GL22114-PA 5..106 6..107 161 35.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 22:37:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14725-PA 375 GA14725-PA 7..371 3..352 944 51.7 Plus
Dpse\GA15068-PA 400 GA15068-PA 5..400 6..344 520 33.2 Plus
Dpse\GA11182-PA 333 GA11182-PA 6..327 6..340 436 33 Plus
Dpse\GA27571-PA 349 GA27571-PA 5..331 6..333 412 32.4 Plus
Dpse\GA20857-PA 401 GA20857-PA 6..329 6..335 391 31 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 22:37:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16437-PA 377 GM16437-PA 1..377 1..372 1746 88.9 Plus
Dsec\GM23960-PA 412 GM23960-PA 5..407 6..342 561 34.6 Plus
Dsec\GM23759-PA 399 GM23759-PA 6..368 6..366 463 32.6 Plus
Dsec\GM26322-PA 346 GM26322-PA 2..327 6..333 444 35.2 Plus
Dsec\GM23758-PA 312 GM23758-PA 1..312 1..342 414 31.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 22:37:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21591-PA 377 GD21591-PA 1..377 1..372 1680 90.2 Plus
Dsim\GD18769-PA 413 GD18769-PA 5..408 6..342 553 34.6 Plus
Dsim\GD20849-PA 397 GD20849-PA 48..378 1..333 460 35.4 Plus
Dsim\GD18570-PA 399 GD18570-PA 6..344 6..349 446 32.9 Plus
Dsim\GD18569-PA 312 GD18569-PA 1..304 1..334 415 32.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 22:37:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23093-PA 378 GJ23093-PA 5..374 6..352 867 46.1 Plus
Dvir\GJ22679-PA 375 GJ22679-PA 6..335 6..333 433 34.9 Plus
Dvir\GJ22564-PA 424 GJ22564-PA 247..411 170..334 430 50 Plus
Dvir\GJ22678-PA 361 GJ22678-PA 6..343 6..333 424 32.2 Plus
Dvir\GJ24681-PA 402 GJ24681-PA 7..391 6..359 416 29.3 Plus
Dvir\GJ22564-PA 424 GJ22564-PA 5..180 6..176 163 30.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 22:37:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12137-PA 319 GK12137-PA 4..319 5..354 822 49 Plus
Dwil\GK11090-PA 394 GK11090-PA 3..382 4..340 561 33.9 Plus
Dwil\GK11273-PA 347 GK11273-PA 1..330 1..333 461 33 Plus
Dwil\GK11276-PA 396 GK11276-PA 6..359 6..333 423 30.5 Plus
Dwil\GK11270-PA 359 GK11270-PA 4..344 6..333 395 30.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 22:37:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10953-PA 362 GE10953-PA 1..361 1..354 1441 79.5 Plus
Dyak\GE24186-PA 431 GE24186-PA 212..428 124..344 466 41.9 Plus
Dyak\GE24832-PA 344 GE24832-PA 1..331 1..333 442 34.8 Plus
Dyak\GE25903-PA 398 GE25903-PA 6..344 6..349 433 32.1 Plus
Dyak\GE25902-PA 306 GE25902-PA 1..301 1..342 421 31.4 Plus
Dyak\GE24186-PA 431 GE24186-PA 5..75 6..78 174 47.9 Plus

LP07209.hyp Sequence

Translation from 62 to 1180

> LP07209.hyp
MPNRNCRTCGLFIFCSTPSNLFEEPNSVMLHQIEVLTGLFLLGGPGNELP
PFICSPCELDLQTAIAFRERVIRTQKTLQESPNLGNAELIESFAVGVEKE
IQYAEEVTEIEVIDLLPEEHLLEETEEPYEICEQNEQPQVKVPAQEKKLR
RSTKTTPTVFTSVKFADNSQATRTQWSRLTEDEVVALKRERRKRDCICEQ
CGRHFTCPSNFKLHLLRHTGVKSFACDQCSQQFYTATLLRRHQELHAGNA
LFQCRYCEATYSNASGRIQHERMRHTNVKPFTCKECNKSFAMSGKLRTHM
LSHTGVRAFHCDSCQVSFVRRSHLTSHYRSKGHAHTSSAQAALDNPVELD
VKASNGMQTGAKDEALLGKSGS*

LP07209.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:16:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG1792-PA 372 CG1792-PA 1..372 1..372 1974 100 Plus
ranshi-PA 346 CG9793-PA 1..346 1..346 485 34.7 Plus
CG8159-PB 399 CG8159-PB 6..349 6..354 476 34.2 Plus
CG18764-PA 409 CG18764-PA 159..395 90..333 476 39.1 Plus
CG11762-PA 312 CG11762-PA 1..310 1..340 421 29.5 Plus
CG18764-PA 409 CG18764-PA 5..340 6..334 203 26.2 Plus