Clone LP07441 Report

Search the DGRC for LP07441

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:74
Well:41
Vector:pOT2
Associated Gene/TranscriptCG5846-RA
Protein status:LP07441.pep: gold
Preliminary Size:1634
Sequenced Size:1615

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5846 2001-01-01 Release 2 assignment
CG5846 2001-10-10 Blastp of sequenced clone
CG5846 2003-01-01 Sim4 clustering to Release 3
CG5846 2008-04-29 Release 5.5 accounting
CG5846 2008-08-15 Release 5.9 accounting
CG5846 2008-12-18 5.12 accounting

Clone Sequence Records

LP07441.complete Sequence

1615 bp (1615 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061547

> LP07441.complete
GGTGAGGTACTTCTCGGTGACATCCGCGCCAGAAGCCGACCTGGTCATCG
AGCCCTGCGCCTGCGTCACCTTTAGATTGTTGTGGCTGCCGCCCACGTCA
GAGACTCCGTTGTGGGAAGCATCACTGGACTTGTGCTGCTGATGCTGCTT
GTACGGCTTGCCTCCCTCCAGGGGTGGCTCACTGGCGTCCGACTCGCCCT
TGGAACTCGTGTTGCCCATCTTGGTGATGTTTCGACGCAATTAATTTGGG
GCAGTGGAAACGTACAACGAAAGGGCATAAAAAAGGCCAAACGCAGGTTT
GCACTGAAAACAAATTGGCGAGGCGCAACAGGTGCAGGGAAGTTTTGGCC
AAAGAAACAACTGCGCCGCGTCGCAAAACCTGTTATGAAACACACAAACA
CAGTGCTAACAAATCGGGTAAATATATTTACATAATTAAACGCAAATTAA
GCTTTGAAACGAGAAAATAAAAACAAACCAATCGAATGTGACCGTGCTGG
AGTTGCAAATTAATGCTGATTACAATGTGGCTTTACCACACCACAGAAAA
ATCTACAGCAACTAGAAGATAGGTGTACCAGTTATATGATGCCCTGTTAT
TTTCTAGTTTTATGATTATGTTAGCGTTTGACATAAATAAATTTTTATTT
GTTTAAAATACGAGACATTTTAACGGTAAATCAATTTTAAATTTTATATT
GAAAGAATTTATATTAAGATGGCATTTTATAATCTTGTATATCATTAAGT
TCGAGCTATTATACCCTTTGGGGCTTCCAATACAGGGTATTAATGGTAAA
TATAACCAAAACAAATGGTGGCACCAGCAAACACAATCCAAACTAATGCG
AATTCCGACGACGATGAGGGAGTGCGGTCGGCGCCTACCTCCATGCTGGT
GCTGGACGCCAAGCGGAAGAGCGCCTTCTTGCCGTACCGCCCCCAGTCCA
CCGTGCTGACCAACTTGCAGCGCGGCAATACGGAGGCCACCTTTTGCCCC
GTCGAAGTTTCGCTCTCCTTTCACGAACGCGCTGGCCAAGGCGAGATCAC
GGAGGAGCAGGTGGCAGCGGAAAGAGCGCGTCAGCAGAACATTGATTACA
AGGATGCACATGGTTTCACAGCCTTACATTGGGCAGCCTCCTACGGTCAA
CTGGTTTCCGTGCAGCTCCTCGTCGCGGCTGGTGCCAATGTGAACACTAT
GGCTCCAGATTTGATTAGTCCTCTACTCCTAGCTGCCGCCGGTGGGCATA
ACGAGATCGTCCGCTTCTTGCTGGAACACGGCGCTGATTCGGGCCACATG
GACATCGTTGGAAACACGGCGCTTATGTACGCAGCGGCCGGCAATCATCC
GCATACTTGCAACGAGCTCCTGGCCAAAGACCTGGATCTAAGTGCCACCA
ACGAGGACGGAGACACGGCCTACTCGCTGGCCGTAGAGCATGGGGCTCAT
CTGGCGCAGGCGCTACTGGAGCAGTACATGACGGCCATAATCACAGCGGG
AGCCTTCGGTAGTATTTAATTGTGCGTAGATAATAATTAGGATATTCTTA
ATCATTTTTAAATTTTGTTTTTGTCAATAATAGATGTTGGAAACCCAAAA
AAAAAAAAAAAAAAA

LP07441.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:11:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG5846-RA 1660 CG5846-RA 1..1597 1..1597 7985 100 Plus
CG5846.a 1598 CG5846.a 1..1521 1..1521 7605 100 Plus
CG4658-RA 2333 CG4658-RA 1..521 521..1 2605 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 00:08:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 9955143..9956738 1596..1 7980 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:08:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG5846-RB 705 CG5846-PB 1..705 815..1519 3525 100 Plus
CG5846-RA 705 CG5846-PA 1..705 815..1519 3525 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:52:00 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:08:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG5846-RB 952 CG5846-RB 105..952 749..1596 4240 100 Plus
CG5846-RA 845 CG5846-RA 1..808 789..1596 4040 100 Plus
CG4658-RD 2486 CG4658-RD 1..676 676..1 3380 100 Minus
CG5846-RB 952 CG5846-RB 1..105 571..675 525 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 00:08:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG5846-PB 234 CG5846-PB 1..234 815..1516 1192 100 Plus
CG5846-PA 234 CG5846-PA 1..234 815..1516 1192 100 Plus
CG4658-PE 491 CG4658-PE 1..73 1..219 380 100 Plus
CG4658-PD 526 CG4658-PD 1..73 1..219 380 100 Plus
CG4658-PA 526 CG4658-PA 1..73 1..219 380 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:08:27
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9956211..9957807 1597..1 7985 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:35:30
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9956211..9957807 1597..1 7985 100 Minus
Blast to na_te.dros performed 2014-11-27 00:08:28
Subject Length Description Subject Range Query Range Score Percent Strand
NOF 4347 NOF FB 4347bp Derived from X51937 (g8297) (Rel. 44, Last updated, Version 6). 3273..3331 748..692 119 69.5 Minus
rover 7318 rover ROVER 7318bp 3757..3800 751..708 112 72.7 Minus

LP07441.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:28:15 Download gff for LP07441.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 9955143..9956738 1..1596 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:38:21 Download gff for LP07441.complete
Subject Subject Range Query Range Percent Splice Strand
CG5846-RA 1..705 815..1519 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:50:54 Download gff for LP07441.complete
Subject Subject Range Query Range Percent Splice Strand
CG5846-RA 1..705 815..1519 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:25:12 Download gff for LP07441.complete
Subject Subject Range Query Range Percent Splice Strand
CG5846-RA 1..705 815..1519 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:20:00 Download gff for LP07441.complete
Subject Subject Range Query Range Percent Splice Strand
CG5846-RA 1..705 815..1519 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:28:15 Download gff for LP07441.complete
Subject Subject Range Query Range Percent Splice Strand
CG5846-RA 1..705 815..1519 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:35:39 Download gff for LP07441.complete
Subject Subject Range Query Range Percent Splice Strand
CG5846-RA 1..1596 1..1596 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:50:54 Download gff for LP07441.complete
Subject Subject Range Query Range Percent Splice Strand
CG5846-RA 1..808 789..1596 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:25:12 Download gff for LP07441.complete
Subject Subject Range Query Range Percent Splice Strand
CG5846-RA 1..808 789..1596 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:20:00 Download gff for LP07441.complete
Subject Subject Range Query Range Percent Splice Strand
CG5846-RA 1..1596 1..1596 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:28:15 Download gff for LP07441.complete
Subject Subject Range Query Range Percent Splice Strand
CG5846-RB 97..952 741..1596 99   Plus
CG5846-RB 1..96 571..666 100 == Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:28:15 Download gff for LP07441.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9956212..9957807 1..1596 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:25:12 Download gff for LP07441.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9956212..9957807 1..1596 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:56:41 Download gff for LP07441.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9956212..9957807 1..1596 100   Minus

LP07441.pep Sequence

Translation from 814 to 1518

> LP07441.pep
MVAPANTIQTNANSDDDEGVRSAPTSMLVLDAKRKSAFLPYRPQSTVLTN
LQRGNTEATFCPVEVSLSFHERAGQGEITEEQVAAERARQQNIDYKDAHG
FTALHWAASYGQLVSVQLLVAAGANVNTMAPDLISPLLLAAAGGHNEIVR
FLLEHGADSGHMDIVGNTALMYAAAGNHPHTCNELLAKDLDLSATNEDGD
TAYSLAVEHGAHLAQALLEQYMTAIITAGAFGSI*

LP07441.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 01:20:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14145-PA 232 GF14145-PA 1..229 1..229 1070 87.3 Plus
Dana\GF24302-PA 448 GF24302-PA 31..154 97..220 172 35.7 Plus
Dana\GF12810-PA 1673 GF12810-PA 221..368 73..221 157 32.7 Plus
Dana\GF17165-PA 676 GF17165-PA 50..203 72..219 150 32.5 Plus
Dana\GF12749-PA 744 GF12749-PA 184..271 99..186 146 44.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 01:20:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23990-PA 234 GG23990-PA 1..234 1..234 1192 95.7 Plus
Dere\GG16167-PA 448 GG16167-PA 31..154 97..220 172 35.7 Plus
Dere\GG22108-PA 1672 GG22108-PA 220..367 73..221 155 32.7 Plus
Dere\GG12063-PA 2124 GG12063-PA 1484..1610 94..219 152 35.4 Plus
Dere\GG20935-PA 664 GG20935-PA 50..204 72..220 150 32.3 Plus
Dere\GG22108-PA 1672 GG22108-PA 206..339 97..234 145 34 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 01:20:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10665-PA 249 GH10665-PA 1..240 1..227 984 77.9 Plus
Dgri\GH14971-PA 448 GH14971-PA 24..154 90..220 175 35.3 Plus
Dgri\GH12155-PA 448 GH12155-PA 24..154 90..220 175 35.3 Plus
Dgri\GH23945-PA 1653 GH23945-PA 523..676 72..228 164 31 Plus
Dgri\GH20639-PA 1606 GH20639-PA 238..368 92..221 153 33.6 Plus
Dgri\GH23945-PA 1653 GH23945-PA 646..767 100..221 147 35.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:20:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG5846-PB 234 CG5846-PB 1..234 1..234 1192 100 Plus
CG5846-PA 234 CG5846-PA 1..234 1..234 1192 100 Plus
Ilk-PA 448 CG10504-PA 31..154 97..220 177 35.7 Plus
CG42672-PL 1476 CG42672-PL 146..293 73..221 165 32.7 Plus
CG42672-PD 1478 CG42672-PD 146..293 73..221 165 32.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 01:20:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10985-PA 247 GI10985-PA 1..247 1..234 969 74.5 Plus
Dmoj\GI13131-PA 453 GI13131-PA 24..154 90..220 179 36.8 Plus
Dmoj\GI19002-PA 1673 GI19002-PA 219..366 73..221 165 34.7 Plus
Dmoj\GI19002-PA 1673 GI19002-PA 100..203 88..191 147 38.5 Plus
Dmoj\GI24181-PA 4101 GI24181-PA 636..782 64..213 147 35.1 Plus
Dmoj\GI18211-PA 314 GI18211-PA 8..161 62..218 146 31.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 01:20:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19193-PA 234 GL19193-PA 1..234 1..234 1104 87.6 Plus
Dper\GL24669-PA 448 GL24669-PA 24..154 90..220 176 35.3 Plus
Dper\GL11335-PA 633 GL11335-PA 92..195 88..191 153 38.5 Plus
Dper\GL11335-PA 633 GL11335-PA 211..358 73..221 153 32.7 Plus
Dper\GL25839-PA 1713 GL25839-PA 1042..1158 96..212 147 33.3 Plus
Dper\GL23419-PA 2532 GL23419-PA 612..756 64..210 147 35.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 01:20:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19174-PA 234 GA19174-PA 1..234 1..234 1104 87.6 Plus
Dpse\GA10358-PA 448 GA10358-PA 24..154 90..220 176 35.3 Plus
Dpse\GA24690-PA 1543 GA24690-PA 92..195 88..191 155 38.5 Plus
Dpse\GA24690-PA 1543 GA24690-PA 211..381 73..234 154 32.4 Plus
Dpse\GA27251-PB 4298 GA27251-PB 650..796 64..213 148 35.8 Plus
Dpse\GA27251-PA 4243 GA27251-PA 637..783 64..213 148 35.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 01:20:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12079-PA 234 GM12079-PA 1..234 1..234 1216 98.3 Plus
Dsec\GM22350-PA 448 GM22350-PA 31..154 97..220 172 35.7 Plus
Dsec\GM15827-PA 1524 GM15827-PA 221..368 73..221 154 32.7 Plus
Dsec\GM16283-PA 2118 GM16283-PA 1478..1604 94..219 152 35.4 Plus
Dsec\GM25809-PA 662 GM25809-PA 48..202 72..220 149 32.3 Plus
Dsec\GM15827-PA 1524 GM15827-PA 207..340 97..234 145 34 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 01:20:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22319-PA 234 GD22319-PA 1..234 1..234 1219 98.3 Plus
Dsim\GD14943-PA 448 GD14943-PA 31..154 97..220 172 35.7 Plus
Dsim\GD18026-PA 2130 GD18026-PA 1490..1616 94..219 152 35.4 Plus
Dsim\GD20385-PA 662 GD20385-PA 48..202 72..220 150 32.3 Plus
Dsim\GD13038-PA 1515 GD13038-PA 337..470 92..226 145 34.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 01:20:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18304-PA 247 GJ18304-PA 1..246 1..233 995 76.8 Plus
Dvir\GJ13879-PA 453 GJ13879-PA 24..154 90..220 175 35.3 Plus
Dvir\GJ19213-PA 1869 GJ19213-PA 919..1037 100..218 156 37.8 Plus
Dvir\GJ19213-PA 1869 GJ19213-PA 796..940 72..219 151 31.5 Plus
Dvir\GJ19968-PA 1703 GJ19968-PA 219..387 73..210 149 30.4 Plus
Dvir\GJ20938-PA 125 GJ20938-PA 15..96 76..159 140 40.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 01:20:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12688-PA 237 GK12688-PA 1..237 1..234 1036 83.2 Plus
Dwil\GK16818-PA 448 GK16818-PA 24..154 90..220 172 35.3 Plus
Dwil\GK21595-PA 1591 GK21595-PA 225..372 73..221 165 35.5 Plus
Dwil\GK21595-PA 1591 GK21595-PA 177..344 93..234 154 29.1 Plus
Dwil\GK24750-PA 330 GK24750-PA 35..163 92..220 154 34.9 Plus
Dwil\GK21595-PA 1591 GK21595-PA 106..209 88..191 146 36.5 Plus
Dwil\GK11005-PA 678 GK11005-PA 50..204 72..220 146 32.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 01:20:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10115-PA 234 GE10115-PA 1..233 1..233 1177 94 Plus
Dyak\GE19735-PA 448 GE19735-PA 31..154 97..220 172 35.7 Plus
Dyak\GE23057-PA 448 GE23057-PA 31..154 97..220 172 35.7 Plus
Dyak\GE12189-PA 1670 GE12189-PA 220..367 73..221 154 32.7 Plus
Dyak\GE10505-PA 2117 GE10505-PA 1486..1612 94..219 153 35.4 Plus
Dyak\GE12189-PA 1670 GE12189-PA 206..339 97..234 145 34 Plus

LP07441.hyp Sequence

Translation from 814 to 1518

> LP07441.hyp
MVAPANTIQTNANSDDDEGVRSAPTSMLVLDAKRKSAFLPYRPQSTVLTN
LQRGNTEATFCPVEVSLSFHERAGQGEITEEQVAAERARQQNIDYKDAHG
FTALHWAASYGQLVSVQLLVAAGANVNTMAPDLISPLLLAAAGGHNEIVR
FLLEHGADSGHMDIVGNTALMYAAAGNHPHTCNELLAKDLDLSATNEDGD
TAYSLAVEHGAHLAQALLEQYMTAIITAGAFGSI*

LP07441.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:37:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG5846-PB 234 CG5846-PB 1..234 1..234 1192 100 Plus
CG5846-PA 234 CG5846-PA 1..234 1..234 1192 100 Plus
Ilk-PA 448 CG10504-PA 31..154 97..220 177 35.7 Plus
CG42672-PL 1476 CG42672-PL 146..293 73..221 165 32.7 Plus
CG42672-PD 1478 CG42672-PD 146..293 73..221 165 32.7 Plus