Clone LP08893 Report

Search the DGRC for LP08893

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:88
Well:93
Vector:pOT2
Associated Gene/TranscriptPfk-RC
Protein status:LP08893.pep: gold
Sequenced Size:2880

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Pfk-RB 2009-06-22 Replacement based on scoring

Clone Sequence Records

LP08893.complete Sequence

2880 bp assembled on 2009-08-19

GenBank Submission: BT099630.1

> LP08893.complete
TGAATACCGCCTGCGAGCGTACATATTGCTAGTAACTGAAAAGCCACGGC
AAGGAGCAGTAGTAGTATTTATAGCCCACTTGGATATAACCCAGCTCCAG
CGGCGCTGCTCGCATAGTTGCAAAACAGGGAAACTCCCTACCGAGTACAA
TAGTGGTTCATAGTGTGTGCTTTGTGCGATATCCGTTACGACCCCAGTTT
GATTTACATATAGTGCAAAAGATTGAAAAATGAATTCCGAGATTAATCAA
CGATTCCTGGCCCGCGGCTCGCAGAAGGACAAAGGACTGGCGGTCTTCAC
CAGCGGCGGGGATTCCCAGGGCATGAATGCCGCCGTGCGAGCCTGTGTCC
GTATGGCCATCTATTTGGGCTGCAAGGTCTACTTCATTCGTGAAGGCTAC
CAGGGCATGGTGGATGGTGGCGACTGCATCCAGGAAGCCAACTGGGCCTC
AGTCTCATCCATTATCCATCGTGGTGGCACCATCATTGGCTCCGCCCGTT
GCCAGGACTTCCGTGAGCGTCAGGGTCGCTTGAAAGCCGCTAACAACCTG
ATTCAGCGAGGAATCACCAATCTGGTGGTCATTGGAGGCGATGGCTCCCT
CACGGGCGCCAATCTGTTCCGTCAGGAGTGGTCCAGCCTGTTGGACGAGC
TGGTCAAGAACAAGACCATTACCACCGAGCAGCAGGAGAAGTTCAATGTC
CTGCACATCGTTGGATTGGTTGGCTCCATCGACAACGATTTCTGTGGCAC
TGACATGACCATCGGCACGGACACGGCACTACATCGCATCATCGAGGCAA
TCGATGCCATCTCCAGTACAGCCTACTCCCATCAGCGCACCTTCATCATG
GAGGTCATGGGTCGTCATTGCGGTTACTTAGCCATATCGGCAGCCATAGC
CACAGAGGCTGATTTTATGTTCATACCCGAGGAGCCGGTGTCAGTCAATT
GGAAGGACGAGATCTGTGTCAAGCTCCACCAGGAGCGATCTGCTGGCCAG
CGTCTGAACATCGTGATTGTGGCCGAGGGAGCCATGGATCGCGAGGGTCA
TCCCATCACAGCCGAGGATGTAAAGAAGGTGATCGACGAGCGTCTGAAGC
ACGATGCCCGCATCACTGTCTTGGGTCACGTGCAGCGCGGTGGCAATCCC
AGTGCCTTCGATCGTATTTTGGCTTGCCGCATGGGAGCTGAGGCCACTTT
GGCCCTGATGGAGGCCACCAAGGACTCGGTGCCAGTGGTCATCTCTCTGG
ACGGCAACCAGGCGGTTCGCGTGCCGCTGATGGAGTGCGTAGAGCGCACC
CAGGCTGTGGCCAAGGCCATGGCGGAGAAACGCTGGGCGGATGCCGTCAA
GCTGCGCGGACGCTCCTTCGAGCGGAATCTGGAGACCTACAAGATGCTGA
CGCGCTTGAAGCCGCCCAAGGAGAACTTCGACGCCGATGGCAAGGGAATC
GAAGGATACCGCCTAGCTGTGATGCATATTGGTGCTCCGGCTTGCGGTAT
GAATGCCGCTGTGCGCAGCTTCGTGCGCAATGCCATCTACCGCGGTGATG
TGGTTTATGGAATCAACGACGGTGTCGAGGGTCTGATTGCCGGAAATGTC
CGCGAGCTGGGCTGGTCGGATGTCTCAGGATGGGTTGGTCAGGGTGGCGC
CTACTTGGGTACCAAACGCACACTGCCTGAGGGCAAGTTCAAGGAGATCG
CCGCTCGTCTCAAGGAGTTTAAGATCCAGGGTCTCCTGATCATTGGTGGC
TTTGAGAGTTACCATGCCGCCGGACAGATCGCCGATCAGCGGGACAACTA
CCCACAGTTCTGCATCCCCATTGTGGTTATTCCATCGACGATTTCGAACA
ATGTGCCCGGCACAGAATTTTCTCTGGGATGCGACACCGGTTTAAATGAG
ATTACGGAGATTTGCGACCGTATCCGTCAGTCGGCACAGGGAACCAAGCG
CCGAGTGTTCGTCATTGAGACGATGGGTGGCTACTGTGGCTATTTGGCCA
CCTTGGCCGGCTTGGCCGGCGGAGCTGATGCCGCCTACATCTACGAGGAG
AAGTTCTCCATCAAAGACCTGCAGCAGGATGTCTACCACATGGCCTCCAA
GATGGCCGAGGGCGTCTCCCGCGGTCTAATCCTGCGAAACGAGAAGGCTA
GCGAGAACTACAGCACGGACTTCATTTACCGCCTGTACTCGGAGGAGGGC
AAGGGCCTCTTCACCTGCCGTATGAACATCCTGGGTCACATGCAGCAGGG
CGGCTCACCCACTCCCTTCGACCGCAACATGGGCACCAAAATGGCCGCCA
AGTGTGTCGACTGGCTGGCCGCCCAGATCAAGGCGAACATCGACGCCAAC
GGCGTAGTCAACTGCAAGTCCCCGGACACCGCCACGCTGCTGGGAATCGT
GTCGCGGCAGTACCGCTTCTCACCGCTGGTCGACCTCATTGCAGAGACGA
ACTTCGATCAACGCATCCCGAAGAAGCAGTGGTGGCTGCGCCTGCGTCCC
CTGCTGCGCATCCTGGCCAAGCACGATTCCGCCTACGAGGAGGAGGGTAT
GTACATCACCGTCGAGGAGGAGTGTGACACTGACGCCGTCGCCTAAGCGG
ACTCGGATCCGGACTCTGATCCCCACTTCCGCTTATCACCACCATCGCTG
CATCGAAGCATCAATGTCCACCTATCCGCACCCTCGAATCAGTTTCTGTG
TTCGCTTTTTAAGTTGTTTTGGCACCGCATCCGATCCGTTTTATGGTTTT
TACCAAGATCAGACGAAGAGGCCCATGACAGCAGCACATACGAAAGTATT
TCATAATCTACAGACGCATAAAAAAGCACAAATACATAACTTATTTATAT
TGCTCGCCAAAAAAAAAAAAAAAAAAAAAA

LP08893.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:33:27
Subject Length Description Subject Range Query Range Score Percent Strand
Pfk-RC 3644 Pfk-RC 342..3200 1..2859 14295 100 Plus
Pfk.e 3546 Pfk.e 252..3102 1..2859 14150 99.7 Plus
Pfk.b 3395 Pfk.b 252..3102 1..2859 14150 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 08:04:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 6003343..6004186 1614..2457 4190 99.8 Plus
chr2R 21145070 chr2R 6002843..6003288 1171..1616 2215 99.8 Plus
chr2R 21145070 chr2R 6004266..6004666 2458..2858 1990 99.8 Plus
chr2R 21145070 chr2R 5998744..5999121 1..378 1890 100 Plus
chr2R 21145070 chr2R 6000150..6000498 372..720 1745 100 Plus
chr2R 21145070 chr2R 6002439..6002635 976..1172 940 98.5 Plus
chr2R 21145070 chr2R 6000553..6000708 718..873 765 99.4 Plus
chr2R 21145070 chr2R 6001662..6001772 873..983 555 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:03:55
Subject Length Description Subject Range Query Range Score Percent Strand
Pfk-RC 2367 CG4001-PC 1..2367 230..2596 11835 100 Plus
Pfk-RB 2367 CG4001-PB 1..2367 230..2596 11160 98.1 Plus
Pfk-RA 2853 CG4001-PA 532..2853 275..2596 10935 98.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:53:11 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:03:53
Subject Length Description Subject Range Query Range Score Percent Strand
Pfk-RC 3188 CG4001-RC 331..3188 1..2858 14290 100 Plus
Pfk-RB 3508 CG4001-RB 331..3188 1..2858 13615 98.4 Plus
Pfk-RA 3217 CG4001-RA 634..3217 275..2858 12245 98.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 08:03:58
Subject Length Description Subject Range Query Range Score Percent Strand
Pfk-PC 788 CG4001-PC 1..782 230..2575 3867 100 Plus
Pfk-PB 788 CG4001-PB 1..782 230..2575 3784 97.8 Plus
Pfk-PA 950 CG4001-PA 178..944 275..2575 3710 97.8 Plus
Pfk-PD 950 CG4001-PD 178..944 275..2575 3703 97.4 Plus
Pfk-PE 922 CG4001-PE 184..916 377..2575 3527 97.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:03:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10115814..10116657 1614..2457 4220 100 Plus
2R 25286936 2R 10115314..10115759 1171..1616 2230 100 Plus
2R 25286936 2R 10116737..10117138 2458..2859 2010 100 Plus
2R 25286936 2R 10111200..10111577 1..378 1890 100 Plus
2R 25286936 2R 10112612..10112960 372..720 1745 100 Plus
2R 25286936 2R 10114910..10115106 976..1172 970 99.5 Plus
2R 25286936 2R 10113015..10113170 718..873 780 100 Plus
2R 25286936 2R 10114125..10114235 873..983 555 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:50:28
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10117013..10117856 1614..2457 4220 100 Plus
2R 25260384 2R 10116513..10116958 1171..1616 2230 100 Plus
2R 25260384 2R 10117936..10118337 2458..2859 2010 100 Plus
2R 25260384 2R 10112399..10112776 1..378 1890 100 Plus
2R 25260384 2R 10113811..10114159 372..720 1745 100 Plus
2R 25260384 2R 10116109..10116305 976..1172 970 99.4 Plus
2R 25260384 2R 10114214..10114369 718..873 780 100 Plus
2R 25260384 2R 10115324..10115434 873..983 555 100 Plus
Blast to na_te.dros performed on 2014-11-27 08:03:52 has no hits.

LP08893.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 09:55:40 Download gff for LP08893.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 6004266..6004666 2458..2858 99   Plus
chr2R 6003344..6004186 1615..2457 99 -> Plus
chr2R 6002844..6003286 1172..1614 99 -> Plus
chr2R 6002446..6002634 983..1171 98 -> Plus
chr2R 6001663..6001771 874..982 100 -> Plus
chr2R 6000554..6000708 719..873 99 -> Plus
chr2R 6000155..6000496 377..718 100 -> Plus
chr2R 5998744..5999119 1..376 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:14:37 Download gff for LP08893.complete
Subject Subject Range Query Range Percent Splice Strand
Pfk-RC 1..2367 230..2596 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:51:19 Download gff for LP08893.complete
Subject Subject Range Query Range Percent Splice Strand
Pfk-RC 1..2367 230..2596 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:35:14 Download gff for LP08893.complete
Subject Subject Range Query Range Percent Splice Strand
Pfk-RC 1..2367 230..2596 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:55:40 Download gff for LP08893.complete
Subject Subject Range Query Range Percent Splice Strand
Pfk-RC 1..2367 230..2596 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-19 12:19:47 Download gff for LP08893.complete
Subject Subject Range Query Range Percent Splice Strand
Pfk-RC 304..3161 1..2858 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:51:19 Download gff for LP08893.complete
Subject Subject Range Query Range Percent Splice Strand
Pfk-RC 304..3161 1..2858 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:35:14 Download gff for LP08893.complete
Subject Subject Range Query Range Percent Splice Strand
Pfk-RC 331..3188 1..2858 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:55:40 Download gff for LP08893.complete
Subject Subject Range Query Range Percent Splice Strand
Pfk-RC 331..3188 1..2858 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:55:40 Download gff for LP08893.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10116737..10117137 2458..2858 100   Plus
2R 10115815..10116657 1615..2457 100 -> Plus
2R 10115315..10115757 1172..1614 100 -> Plus
2R 10114917..10115105 983..1171 100 -> Plus
2R 10114126..10114234 874..982 100 -> Plus
2R 10113016..10113170 719..873 100 -> Plus
2R 10112617..10112958 377..718 100 -> Plus
2R 10111200..10111575 1..376 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:35:14 Download gff for LP08893.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6004242..6004642 2458..2858 100   Plus
arm_2R 6003320..6004162 1615..2457 100 -> Plus
arm_2R 6002820..6003262 1172..1614 100 -> Plus
arm_2R 6002422..6002610 983..1171 100 -> Plus
arm_2R 6001631..6001739 874..982 100 -> Plus
arm_2R 6000521..6000675 719..873 100 -> Plus
arm_2R 6000122..6000463 377..718 100 -> Plus
arm_2R 5998705..5999080 1..376 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:27:22 Download gff for LP08893.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10117936..10118336 2458..2858 100   Plus
2R 10117014..10117856 1615..2457 100 -> Plus
2R 10116514..10116956 1172..1614 100 -> Plus
2R 10116116..10116304 983..1171 100 -> Plus
2R 10115325..10115433 874..982 100 -> Plus
2R 10114215..10114369 719..873 100 -> Plus
2R 10113816..10114157 377..718 100 -> Plus
2R 10112399..10112774 1..376 100 -> Plus

LP08893.pep Sequence

Translation from 229 to 2595

> LP08893.pep
MNSEINQRFLARGSQKDKGLAVFTSGGDSQGMNAAVRACVRMAIYLGCKV
YFIREGYQGMVDGGDCIQEANWASVSSIIHRGGTIIGSARCQDFRERQGR
LKAANNLIQRGITNLVVIGGDGSLTGANLFRQEWSSLLDELVKNKTITTE
QQEKFNVLHIVGLVGSIDNDFCGTDMTIGTDTALHRIIEAIDAISSTAYS
HQRTFIMEVMGRHCGYLAISAAIATEADFMFIPEEPVSVNWKDEICVKLH
QERSAGQRLNIVIVAEGAMDREGHPITAEDVKKVIDERLKHDARITVLGH
VQRGGNPSAFDRILACRMGAEATLALMEATKDSVPVVISLDGNQAVRVPL
MECVERTQAVAKAMAEKRWADAVKLRGRSFERNLETYKMLTRLKPPKENF
DADGKGIEGYRLAVMHIGAPACGMNAAVRSFVRNAIYRGDVVYGINDGVE
GLIAGNVRELGWSDVSGWVGQGGAYLGTKRTLPEGKFKEIAARLKEFKIQ
GLLIIGGFESYHAAGQIADQRDNYPQFCIPIVVIPSTISNNVPGTEFSLG
CDTGLNEITEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLAGLAGGAD
AAYIYEEKFSIKDLQQDVYHMASKMAEGVSRGLILRNEKASENYSTDFIY
RLYSEEGKGLFTCRMNILGHMQQGGSPTPFDRNMGTKMAAKCVDWLAAQI
KANIDANGVVNCKSPDTATLLGIVSRQYRFSPLVDLIAETNFDQRIPKKQ
WWLRLRPLLRILAKHDSAYEEEGMYITVEEECDTDAVA*

LP08893.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 04:58:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12020-PA 788 GF12020-PA 1..788 1..788 3917 95.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 04:58:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24141-PA 950 GG24141-PA 178..950 16..788 3928 97.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 04:58:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21789-PA 838 GH21789-PA 1..838 1..788 3829 88.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 04:58:42
Subject Length Description Subject Range Query Range Score Percent Strand
Pfk-PC 788 CG4001-PC 1..788 1..788 4086 100 Plus
Pfk-PB 788 CG4001-PB 1..788 1..788 4003 97.8 Plus
Pfk-PA 950 CG4001-PA 178..950 16..788 3929 97.8 Plus
Pfk-PD 950 CG4001-PD 178..950 16..788 3922 97.4 Plus
Pfk-PE 922 CG4001-PE 184..922 50..788 3746 97.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 04:58:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20539-PA 836 GI20539-PA 1..836 1..788 3829 88.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 04:58:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17610-PA 788 GL17610-PA 1..788 1..788 3862 93.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 04:58:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17840-PB 788 GA17840-PB 1..788 1..788 3920 95.2 Plus
Dpse\GA17840-PA 788 GA17840-PA 1..788 1..788 3867 93.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 04:58:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21187-PA 950 GM21187-PA 178..950 16..788 3925 97.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 04:58:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10715-PA 607 GD10715-PA 2..607 183..788 3131 99.8 Plus
Dsim\GD10715-PA 607 GD10715-PA 231..523 20..334 302 30 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 04:58:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22388-PA 788 GJ22388-PA 1..788 1..788 3905 94.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 04:58:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21487-PA 788 GK21487-PA 1..788 1..788 3943 95.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 04:58:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Pfk-PA 950 GE19339-PA 178..950 16..788 3919 97.4 Plus
Dyak\Pfk-PA 950 GE19339-PA 152..496 382..704 315 28.9 Plus

LP08893.hyp Sequence

Translation from 229 to 2595

> LP08893.hyp
MNSEINQRFLARGSQKDKGLAVFTSGGDSQGMNAAVRACVRMAIYLGCKV
YFIREGYQGMVDGGDCIQEANWASVSSIIHRGGTIIGSARCQDFRERQGR
LKAANNLIQRGITNLVVIGGDGSLTGANLFRQEWSSLLDELVKNKTITTE
QQEKFNVLHIVGLVGSIDNDFCGTDMTIGTDTALHRIIEAIDAISSTAYS
HQRTFIMEVMGRHCGYLAISAAIATEADFMFIPEEPVSVNWKDEICVKLH
QERSAGQRLNIVIVAEGAMDREGHPITAEDVKKVIDERLKHDARITVLGH
VQRGGNPSAFDRILACRMGAEATLALMEATKDSVPVVISLDGNQAVRVPL
MECVERTQAVAKAMAEKRWADAVKLRGRSFERNLETYKMLTRLKPPKENF
DADGKGIEGYRLAVMHIGAPACGMNAAVRSFVRNAIYRGDVVYGINDGVE
GLIAGNVRELGWSDVSGWVGQGGAYLGTKRTLPEGKFKEIAARLKEFKIQ
GLLIIGGFESYHAAGQIADQRDNYPQFCIPIVVIPSTISNNVPGTEFSLG
CDTGLNEITEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLAGLAGGAD
AAYIYEEKFSIKDLQQDVYHMASKMAEGVSRGLILRNEKASENYSTDFIY
RLYSEEGKGLFTCRMNILGHMQQGGSPTPFDRNMGTKMAAKCVDWLAAQI
KANIDANGVVNCKSPDTATLLGIVSRQYRFSPLVDLIAETNFDQRIPKKQ
WWLRLRPLLRILAKHDSAYEEEGMYITVEEECDTDAVA*

LP08893.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:14:25
Subject Length Description Subject Range Query Range Score Percent Strand
Pfk-PC 788 CG4001-PC 1..788 1..788 4086 100 Plus
Pfk-PB 788 CG4001-PB 1..788 1..788 4003 97.8 Plus
Pfk-PA 950 CG4001-PA 178..950 16..788 3929 97.8 Plus
Pfk-PD 950 CG4001-PD 178..950 16..788 3922 97.4 Plus
Pfk-PE 922 CG4001-PE 184..922 50..788 3746 97.3 Plus