Clone LP09219 Report

Search the DGRC for LP09219

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:92
Well:19
Vector:pOT2
Associated Gene/TranscriptCG31789-RA
Protein status:LP09219.pep: gold
Sequenced Size:485

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31789 2003-01-01 Sim4 clustering to Release 3
CG31789 2008-12-18 5.12 accounting

Clone Sequence Records

LP09219.complete Sequence

485 bp assembled on 2008-12-16

GenBank Submission: BT056273.1

> LP09219.complete
ATGAAGGCCTTGCAATTCGCTCTTGTATTTTCGGCCATTCTGGCCATTGC
CTTCGCTGCAAATGCCAGTTGGGGAGCCAAATTGTCCAGCAGTAAGTTGG
TCAGCACTCAGAACGTGACCATCTACAAGAAGGCCAACCAATATGTGAGC
AGTCTCATCAGTTTCCCACTGGCGGGCCAGAGCAACACTAAAACCATTCG
GTACATTAGCATAACTGATAGGTTTACCAACAGTTCGGGACCTTACTCCA
CCTTGTGGTCCGGTGGACCAGGATTCATCAATGCCCAGGTCAATGTCACA
AGCCAGTTTTCTCAAGGAATCAATGTAACTGCTCAATTTTGGGTGGATGC
CTAAACCTACAACTTTTCCGTATACAAATTTTAAAATATTCTGTTTTGCA
ATGTATTTTAAATGTAATTCCGAATTGGTAAATAATTATTTTCAAATCCC
AAGTCGATAAAAAAAAAAAAAAAAAAAAAAAAAAA

LP09219.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:21:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG31789-RA 663 CG31789-RA 69..529 1..461 2305 100 Plus
CG31789.a 504 CG31789.a 159..445 175..461 1435 100 Plus
CG31789.a 504 CG31789.a 15..159 1..145 725 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 02:20:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 18604887..18605171 174..458 1395 99.3 Plus
chr2L 23010047 chr2L 18604652..18604826 1..175 875 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 02:20:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG31789-RC 354 CG31789-PC 1..354 1..354 1770 100 Plus
CG31789-RB 354 CG31789-PB 1..354 1..354 1770 100 Plus
CG31789-RA 354 CG31789-PA 1..354 1..354 1770 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:53:21 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:20:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG31789-RC 695 CG31789-RC 15..472 1..458 2290 100 Plus
CG31789-RB 472 CG31789-RB 15..472 1..458 2290 100 Plus
CG31789-RA 534 CG31789-RA 15..472 1..458 2290 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 02:20:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG31789-PC 117 CG31789-PC 1..117 1..351 495 100 Plus
CG31789-PB 117 CG31789-PB 1..117 1..351 495 100 Plus
CG31789-PA 117 CG31789-PA 1..117 1..351 495 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 02:20:35
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18606177..18606464 174..461 1440 100 Plus
2L 23513712 2L 18605942..18606116 1..175 875 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:05:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18606177..18606464 174..461 1440 100 Plus
2L 23513712 2L 18605942..18606116 1..175 875 100 Plus
Blast to na_te.dros performed on 2014-11-27 02:20:36 has no hits.

LP09219.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 04:15:35 Download gff for LP09219.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 18604888..18605171 175..458 99   Plus
chr2L 18604652..18604825 1..174 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:04:17 Download gff for LP09219.complete
Subject Subject Range Query Range Percent Splice Strand
CG31789-RA 1..354 1..354 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:45:10 Download gff for LP09219.complete
Subject Subject Range Query Range Percent Splice Strand
CG31789-RA 1..354 1..354 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:59:03 Download gff for LP09219.complete
Subject Subject Range Query Range Percent Splice Strand
CG31789-RA 1..354 1..354 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:15:35 Download gff for LP09219.complete
Subject Subject Range Query Range Percent Splice Strand
CG31789-RA 1..354 1..354 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-16 13:58:24 Download gff for LP09219.complete
Subject Subject Range Query Range Percent Splice Strand
CG31789-RA 1..458 1..458 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:45:10 Download gff for LP09219.complete
Subject Subject Range Query Range Percent Splice Strand
CG31789-RA 1..458 1..458 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:59:03 Download gff for LP09219.complete
Subject Subject Range Query Range Percent Splice Strand
CG31789-RA 15..472 1..458 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:15:35 Download gff for LP09219.complete
Subject Subject Range Query Range Percent Splice Strand
CG31789-RA 15..472 1..458 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 04:15:35 Download gff for LP09219.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18606178..18606461 175..458 100   Plus
2L 18605942..18606115 1..174 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:59:03 Download gff for LP09219.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18606178..18606461 175..458 100   Plus
arm_2L 18605942..18606115 1..174 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:30:51 Download gff for LP09219.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18606178..18606461 175..458 100   Plus
2L 18605942..18606115 1..174 100 -> Plus

LP09219.pep Sequence

Translation from 0 to 353

> LP09219.pep
MKALQFALVFSAILAIAFAANASWGAKLSSSKLVSTQNVTIYKKANQYVS
SLISFPLAGQSNTKTIRYISITDRFTNSSGPYSTLWSGGPGFINAQVNVT
SQFSQGINVTAQFWVDA*

LP09219.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:49:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15061-PA 116 GF15061-PA 1..116 1..116 357 65.5 Plus
Dana\GF11989-PA 115 GF11989-PA 1..113 4..114 139 34.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:49:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21120-PA 117 GG21120-PA 1..117 1..117 487 89.7 Plus
Dere\GG22531-PA 112 GG22531-PA 1..110 4..114 141 32.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:49:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21596-PA 116 GH21596-PA 5..114 10..114 198 38.2 Plus
Dgri\GH21597-PA 116 GH21597-PA 1..114 1..114 195 36 Plus
Dgri\GH17985-PA 116 GH17985-PA 5..114 10..114 192 38.2 Plus
Dgri\GH21729-PA 120 GH21729-PA 18..111 14..107 145 31.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:49:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG31789-PC 117 CG31789-PC 1..117 1..117 586 100 Plus
CG31789-PB 117 CG31789-PB 1..117 1..117 586 100 Plus
CG31789-PA 117 CG31789-PA 1..117 1..117 586 100 Plus
CG13323-PB 112 CG13323-PB 1..110 4..114 145 32.5 Plus
CG13323-PA 112 CG13323-PA 1..110 4..114 145 32.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:49:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19567-PA 118 GI19567-PA 1..114 1..114 214 41.2 Plus
Dmoj\GI18871-PA 119 GI18871-PA 10..110 6..107 145 31.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:49:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10591-PA 116 GL10591-PA 1..114 1..114 179 36.8 Plus
Dper\GL16235-PA 120 GL16235-PA 6..111 2..107 164 33 Plus
Dper\GL10590-PA 116 GL10590-PA 1..114 1..114 146 31.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:49:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12205-PA 116 GA12205-PA 1..114 1..114 179 36.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:49:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17281-PA 117 GM17281-PA 1..117 1..117 568 95.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:49:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24143-PA 117 GD24143-PA 1..117 1..117 563 94.9 Plus
Dsim\GD25794-PA 112 GD25794-PA 1..110 4..114 137 29.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:49:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21142-PA 116 GJ21142-PA 1..114 1..114 207 40.4 Plus
Dvir\GJ21904-PA 118 GJ21904-PA 9..109 6..107 154 32.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:49:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10198-PA 115 GK10198-PA 1..114 1..114 414 70.2 Plus
Dwil\GK21639-PA 116 GK21639-PA 1..114 1..114 186 38.6 Plus
Dwil\GK21944-PA 112 GK21944-PA 4..103 8..107 153 31 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:49:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14474-PA 117 GE14474-PA 1..117 1..117 542 90.6 Plus
Dyak\GE13194-PA 117 GE13194-PA 1..117 1..117 542 90.6 Plus

LP09219.hyp Sequence

Translation from 1 to 353

> LP09219.hyp
MKALQFALVFSAILAIAFAANASWGAKLSSSKLVSTQNVTIYKKANQYVS
SLISFPLAGQSNTKTIRYISITDRFTNSSGPYSTLWSGGPGFINAQVNVT
SQFSQGINVTAQFWVDA*

LP09219.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:24:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG31789-PC 117 CG31789-PC 1..117 1..117 586 100 Plus
CG31789-PB 117 CG31789-PB 1..117 1..117 586 100 Plus
CG31789-PA 117 CG31789-PA 1..117 1..117 586 100 Plus
CG13323-PB 112 CG13323-PB 1..110 4..114 145 32.5 Plus
CG13323-PA 112 CG13323-PA 1..110 4..114 145 32.5 Plus