Clone LP10114 Report

Search the DGRC for LP10114

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:101
Well:14
Vector:pOT2
Associated Gene/TranscriptCG18858-RA
Protein status:LP10114.pep: gold
Sequenced Size:1423

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18858 2008-04-29 Manual selection by Sue Celniker

Clone Sequence Records

LP10114.complete Sequence

1423 bp assembled on 2009-04-22

GenBank Submission: BT082071.1

> LP10114.complete
TTTACAACGCAACGCACAATGAGGCTCAAATCGGGAGTGCTTTCGCTGCT
CCTGCTGACCACCTTCTTGGCCCTGGGCGAGTGCTTTTGGCCATTTAGCA
AATGGCATGGAAGAAATGATAATCCTTCTGCCCCCCCTGAACCCAAGCTG
TCGCCAGTGATATTCGTACCCGGTGACGGAGGCTCCCAAATGGATGCTCG
GCTAAATAAGCCCAACTCTCCCTATTTAATTTGCCAAAAGACCCACGATT
GGTACAACCTGTGGCTGGATCTGGAGCAGTTGGTCATCCCCATGGTCTAC
TGTTGGATAGACAATGTCAAGCTGTACTACGACAAGGTCACGAGGACCAC
CCACAACACTCCTGGTGTGGAGACGAGGATACCCGGCTGGGGCAATCCCG
AGGTGGTCGAGTGGATCGATCCCACCAAGAACAGCGCCGGAGCCTACTTC
AAGGATATAGCCAATGAGCTGGTGAAACTTGGATATATTCGCAAACAAAA
TATTCATGGAGCACCCTATGACTTCCGCAAAGCGCCAAATGAGAACCAAC
AGTTCTTCATCGATCTCAAGCAGCTGGTGGAGGACTCCTATGAGGCCAAC
AATCAGTCGGCTGTGACCTTCATCTCGCACAGCATGGGCAGTCTCATGAC
CCTGGTTTTCTTGCAGGAGCAAACCCTCCAATGGAAGGCGAAATACGTGA
AGCGCATGATCAGCCTGGCGGGAGTTTGGGCGGGAAGTTTTAAGGCTGTG
AAAGTGTTTGCCATGGGCGATGATCTCGACTCGTTCGCCCTGAGTGCCAA
GATCCTCAAGGCGGAACAGATAACACACCCATCCACGGCCTGGTTGCTGC
CCTCGCCACTGTTTTGGAAGCCATCCGAGGTGCTCGCCATGACTCCAAGC
AGAAACTATACGATGGCACAGCTGGAAGAGTTCTTCAAAGACCTCGACTA
CATGACGGGCTGGGAAATGCGCAAGGACACGATTCGGTACAACCGAAACT
TCGATCCACCGAATGTGGAACTGCACTGTCTCTATGGCGAAGGCATCGAC
ACGGTCGAGAGACTGCAGTACAAGAAATCGGACATTAGTGGGGAAACGCC
CAAGTTGATAATGGGTCTCGGCGACGGCACCGTTAACCAGCGTTCTCTGC
GAGCCTGCAAATATTGGGCGGGCTATTCTAAAGCGCCTATAAACACGCTC
GCTCTCCAGAACGTGGACCACTTGCACATCCTGTCCAATCCGGACGTCCT
CAAATATATCCGCACTGTCATGCAGCAGCCGTAATGTCAATTGTAGCACT
TAAGTATGCGAAGAGCTTCGTGATGCTCAAAATCTAAAGCTAATGACAAT
GCCAATTTTATTGTTAAATAAATGTAACTCGTTAAGTAGCGCAAGCGATA
AGAACAAAAAAAAAAAAAAAAAA

LP10114.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:21:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG18858-RA 2118 CG18858-RA 621..2027 1..1407 7005 99.8 Plus
CG31683-RA 2040 CG31683-RA 428..1834 1..1407 6975 99.7 Plus
CG31683.a 3128 CG31683.a 428..1834 1..1407 6975 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 02:20:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 20455903..20456429 1061..535 2620 99.8 Minus
chr2L 23010047 chr2L 20446786..20447308 1061..539 2600 99.8 Minus
chr2L 23010047 chr2L 20456489..20456866 543..166 1875 99.7 Minus
chr2L 23010047 chr2L 20447372..20447749 543..166 1860 99.5 Minus
chr2L 23010047 chr2L 20446377..20446722 1405..1060 1700 99.4 Minus
chr2L 23010047 chr2L 20455494..20455839 1405..1060 1700 99.4 Minus
chr2L 23010047 chr2L 20447816..20447981 166..1 830 100 Minus
chr2L 23010047 chr2L 20456933..20457098 166..1 830 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 02:19:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG18858-RB 1266 CG18858-PB 1..1266 19..1284 6330 100 Plus
CG18858-RA 1266 CG18858-PA 1..1266 19..1284 6330 100 Plus
CG31683-RB 1266 CG31683-PB 1..1266 19..1284 6300 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:54:16 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:19:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG18858-RB 2029 CG18858-RB 413..1817 1..1405 6995 99.9 Plus
CG18858-RA 1817 CG18858-RA 413..1817 1..1405 6995 99.9 Plus
CG31683-RB 1823 CG31683-RB 419..1823 1..1405 6965 99.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 02:20:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG18858-PB 421 CG18858-PB 21..421 79..1281 2175 100 Plus
CG18858-PA 421 CG18858-PA 21..421 79..1281 2175 100 Plus
CG31683-PB 421 CG31683-PB 21..421 79..1281 2168 99.5 Plus
CG31683-PA 421 CG31683-PA 21..421 79..1281 2168 99.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 02:19:55
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20457468..20457994 1061..535 2620 99.8 Minus
2L 23513712 2L 20448351..20448873 1061..539 2600 99.8 Minus
2L 23513712 2L 20458054..20458431 543..166 1875 99.7 Minus
2L 23513712 2L 20448937..20449314 543..166 1860 99.5 Minus
2L 23513712 2L 20447940..20448287 1407..1060 1710 99.4 Minus
2L 23513712 2L 20457057..20457404 1407..1060 1710 99.4 Minus
2L 23513712 2L 20449381..20449546 166..1 830 100 Minus
2L 23513712 2L 20458498..20458663 166..1 830 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:05:01
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20457468..20457994 1061..535 2620 99.8 Minus
2L 23513712 2L 20448351..20448873 1061..539 2600 99.8 Minus
2L 23513712 2L 20458054..20458431 543..166 1875 99.7 Minus
2L 23513712 2L 20448937..20449314 543..166 1860 99.4 Minus
2L 23513712 2L 20457057..20457404 1407..1060 1710 99.4 Minus
2L 23513712 2L 20447940..20448287 1407..1060 1710 99.4 Minus
2L 23513712 2L 20458498..20458663 166..1 830 100 Minus
2L 23513712 2L 20449381..20449546 166..1 830 100 Minus
Blast to na_te.dros performed on 2014-11-27 02:19:56 has no hits.

LP10114.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 04:15:19 Download gff for LP10114.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 20456933..20457098 1..166 100   Minus
chr2L 20456494..20456865 167..538 100 <- Minus
chr2L 20455903..20456425 539..1061 100 <- Minus
chr2L 20455494..20455837 1062..1405 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:50:49 Download gff for LP10114.complete
Subject Subject Range Query Range Percent Splice Strand
CG18858-RA 1..1266 19..1284 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:44:52 Download gff for LP10114.complete
Subject Subject Range Query Range Percent Splice Strand
CG18858-RA 1..1266 19..1284 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:58:52 Download gff for LP10114.complete
Subject Subject Range Query Range Percent Splice Strand
CG18858-RA 1..1266 19..1284 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:15:19 Download gff for LP10114.complete
Subject Subject Range Query Range Percent Splice Strand
CG18858-RA 1..1266 19..1284 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-22 09:22:21 Download gff for LP10114.complete
Subject Subject Range Query Range Percent Splice Strand
CG18858-RA 420..1824 1..1405 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:44:52 Download gff for LP10114.complete
Subject Subject Range Query Range Percent Splice Strand
CG18858-RA 420..1824 1..1405 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:58:52 Download gff for LP10114.complete
Subject Subject Range Query Range Percent Splice Strand
CG18858-RA 413..1817 1..1405 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:15:19 Download gff for LP10114.complete
Subject Subject Range Query Range Percent Splice Strand
CG18858-RA 413..1817 1..1405 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 04:15:19 Download gff for LP10114.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20458498..20458663 1..166 100   Minus
2L 20458059..20458430 167..538 100 <- Minus
2L 20457468..20457990 539..1061 100 <- Minus
2L 20457059..20457402 1062..1405 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:58:52 Download gff for LP10114.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20458498..20458663 1..166 100   Minus
arm_2L 20458059..20458430 167..538 100 <- Minus
arm_2L 20457468..20457990 539..1061 100 <- Minus
arm_2L 20457059..20457402 1062..1405 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:30:35 Download gff for LP10114.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20458498..20458663 1..166 100   Minus
2L 20458059..20458430 167..538 100 <- Minus
2L 20457468..20457990 539..1061 100 <- Minus
2L 20457059..20457402 1062..1405 99 <- Minus

LP10114.pep Sequence

Translation from 0 to 1283

> LP10114.pep
FTTQRTMRLKSGVLSLLLLTTFLALGECFWPFSKWHGRNDNPSAPPEPKL
SPVIFVPGDGGSQMDARLNKPNSPYLICQKTHDWYNLWLDLEQLVIPMVY
CWIDNVKLYYDKVTRTTHNTPGVETRIPGWGNPEVVEWIDPTKNSAGAYF
KDIANELVKLGYIRKQNIHGAPYDFRKAPNENQQFFIDLKQLVEDSYEAN
NQSAVTFISHSMGSLMTLVFLQEQTLQWKAKYVKRMISLAGVWAGSFKAV
KVFAMGDDLDSFALSAKILKAEQITHPSTAWLLPSPLFWKPSEVLAMTPS
RNYTMAQLEEFFKDLDYMTGWEMRKDTIRYNRNFDPPNVELHCLYGEGID
TVERLQYKKSDISGETPKLIMGLGDGTVNQRSLRACKYWAGYSKAPINTL
ALQNVDHLHILSNPDVLKYIRTVMQQP*

LP10114.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 08:00:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14774-PA 422 GF14774-PA 1..422 7..427 1876 83.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 08:00:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21570-PA 421 GG21570-PA 21..421 27..427 2045 92.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 08:00:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11651-PA 421 GH11651-PA 7..421 11..427 1801 76.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:00:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG18858-PB 421 CG18858-PB 1..421 7..427 2266 100 Plus
CG18858-PA 421 CG18858-PA 1..421 7..427 2266 100 Plus
CG31683-PB 421 CG31683-PB 1..421 7..427 2259 99.5 Plus
CG31683-PA 421 CG31683-PA 1..421 7..427 2259 99.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 08:00:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17953-PA 421 GI17953-PA 1..421 7..427 1790 77.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 08:00:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26411-PA 426 GL26411-PA 1..426 7..427 1853 80.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 08:00:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15103-PA 426 GA15103-PA 1..426 7..427 1855 80.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 08:00:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23325-PA 421 GM23325-PA 1..421 7..427 2245 98.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 08:00:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21702-PA 391 GD21702-PA 17..391 53..427 1980 97.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 08:00:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17724-PA 423 GJ17724-PA 20..423 24..427 1799 80.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:00:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18118-PA 422 GK18118-PA 1..422 7..427 1700 73.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 08:00:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12591-PA 421 GE12591-PA 1..421 7..427 2053 93.6 Plus

LP10114.hyp Sequence

Translation from 0 to 1283

> LP10114.hyp
FTTQRTMRLKSGVLSLLLLTTFLALGECFWPFSKWHGRNDNPSAPPEPKL
SPVIFVPGDGGSQMDARLNKPNSPYLICQKTHDWYNLWLDLEQLVIPMVY
CWIDNVKLYYDKVTRTTHNTPGVETRIPGWGNPEVVEWIDPTKNSAGAYF
KDIANELVKLGYIRKQNIHGAPYDFRKAPNENQQFFIDLKQLVEDSYEAN
NQSAVTFISHSMGSLMTLVFLQEQTLQWKAKYVKRMISLAGVWAGSFKAV
KVFAMGDDLDSFALSAKILKAEQITHPSTAWLLPSPLFWKPSEVLAMTPS
RNYTMAQLEEFFKDLDYMTGWEMRKDTIRYNRNFDPPNVELHCLYGEGID
TVERLQYKKSDISGETPKLIMGLGDGTVNQRSLRACKYWAGYSKAPINTL
ALQNVDHLHILSNPDVLKYIRTVMQQP*

LP10114.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:05:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG18858-PB 421 CG18858-PB 1..421 7..427 2266 100 Plus
CG18858-PA 421 CG18858-PA 1..421 7..427 2266 100 Plus
CG31683-PB 421 CG31683-PB 1..421 7..427 2259 99.5 Plus
CG31683-PA 421 CG31683-PA 1..421 7..427 2259 99.5 Plus