Clone LP10412 Report

Search the DGRC for LP10412

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:104
Well:12
Vector:pOT2
Associated Gene/TranscriptAxs-RB
Protein status:LP10412.pep: wuzgold
Preliminary Size:2396
Sequenced Size:2931

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9703 2002-01-01 Sim4 clustering to Release 2
CG9703 2002-05-30 Blastp of sequenced clone
Axs 2008-04-29 Release 5.5 accounting
Axs 2008-08-15 Release 5.9 accounting
Axs 2008-12-18 5.12 accounting

Clone Sequence Records

LP10412.complete Sequence

2931 bp (2931 high quality bases) assembled on 2002-05-30

GenBank Submission: AY118348.1

> LP10412.complete
GGAAAGAAGAGGAGATTCTAGTTAATTTAAACAAATTAAAACCAAATTAA
TTGTGACATATATGATTTATTTTTGTAGTTGTTGCTGTTGTTGTGACAGA
GAGGCGAATCGTTTCGATAACATGGCAGCGATGACGTCACGCGCCACGCA
GCTGGGACAGCAACAAAAACAATTGGATTTGAACCGGCAAGAACTGAATA
TTTTGGCATTATTATTAAAAATTCAGTATTTTGGCATTGGCGCGGGCCAA
GATACACTCATACACGCAATTAGCACACACACGCACACCGCAAGTGCGAG
CGAGATAGCAAGCACTTACTCATGCGAGCGGAGAAGAAAAGCAAAAACAA
AATAAACGAAACTGAGAGAATTCTGCAATATCATATTCGGATGTGGATGT
GATTGTTATATTTTGTTATTAGTTCAGCGACGCCACTCGTCGTCACCCGT
AAACGATGTCCGAAGATGCCAAGAGTCCAGGACCACGCACACGGAACATC
ATCGAGAATCAGCTGTTCCGCCGGCAGCGTAGCCTAAAATTGGAGGCACT
GCAGCGCCAGCGGACCTTGGATTCCAACGATGGGGTGGAGGGATTGGGCG
CAGATACGGAACCCTTCGACAAGACGCACATCGTCATCATCTTTACGGAG
AAGGCCAAGCTAAGACACTGTCAGGATGTGGAGAAGATCATTCAGGAGTT
TGGCATCCAGACCACGCTGGAGATCGTAGGGAAAACCGAAAAGTATCTCT
ACCTATCGGCCAGCGTGGATACTCTGCTCCGTTTGGCCGATGCCGCCGAG
CTGGAGAAGATGACCACCACGCACAGCATGCAAAAGTTCAATCACGGCTG
CATCTCGGACTTTCTACTGCCCGGGATGGGCAAAGAGCAGATCCTGCGCT
ACTGCGAGATACCTGTTCTCATCAAGGACGTAATCCAGGACGGCATTAAG
TCCTACGTGCAAAAGGGCTACATAGAGGATATGTTTCCCCTCCACGATAT
CCTGTATCTCGAACGCTTCAACTGGAACCTGAAACGCACCAAGCTGCCCA
TCGAGGACATCCGGAACTACTTTGGTTCCAGTATAGGTCTTTATTTCGGC
TTCATCGAGTTCTACACGAAGGCACTGATCTTTCCCTCCCTTTTTGGTAT
ACTCCAATATGTATTCGATCTGAACATCTCGCTGGTCTGCAGTTTCTACG
TTGTTTGGACCACGGTGAGTTAAATTGTTAATTTTCAAGGCGAAACAAAG
TAAACCTTTGCACAATAAAAATAAATTGCTTTTACAGCTTATAAATCTAA
GTATAGCATCACTTAAGTGCTCTTAAGTTGGAAACTTTTAAGTGCTATAG
TAAAAATAGCTAGCATGTATGTATTTTGATCTTGCAGTTTTACCAATTTT
CAAGTTTGAATAGTTTAAATATATCTATACACCGACTAAATCATTGCCAC
AAAAAACAGTTAACTAAAGATTAAATACACTAGAGCTGGCATAAAACGTT
ATGGTTTTGGTCTTCCAATCGATTTTATATTAACATATTCCTATATTTTT
AGATTTTCCTGGAGTTGTGGAAGCGTAAGTGTGCCGGCTACTCGTATCGA
TGGGGCACCATTGAGATGAGCAGCCTGGACAAGCCGCGATCCGCATATAC
GGGCCAATTGAAACCGGACCCCATCACCGGCAAGATGACACTCCACTATC
CGATGCGGTACACATACCTGCAGATGTACTGCATCTCGTATCCGGTGGTG
CTGGGCTGTGTGGTTGCCGCCGGCTGGTTTGCCCTCTACCAGTTTCAGAT
CGAAGCCGAGGTGCTGGCGGATTTCGGACCAGACTCCTGGCTGCTGTACG
TGCCGGTTATTGTGCAGTCGGTGCTGATTGCGATCTTTTCGTGGGCATAC
GAAAAGCTGGCCACATTCCTCACCAACCTGGAGAACCATCGAACTCGATC
GCAGTACGATCGTCATCGGGTCAATAAGCTGATGCTCTTCGAGATCGTGA
ATAACTTCTTCTCGCAGTTCTATATTGCCTTCGTGCTGCACGATCTGCGC
CAGCTGAAGTACCAGTTGATGATGCAACTGCTGGTCTTCCAGCTGCTGTG
CATCGCCCAGGAGATTGGTATACCGCTGCTGGCGGTGCTGCGCCAGAAGT
ACGCCGAGTTCCGTCATCGCGAGGTGGCCGAGGAGAAGCTGCGATCCATC
AGTGATCTGCCGCGCTACGAGCAATCGTTCTACGAATCCGGACTAGATGA
ATATCATTCCACGTACGAGGACTACCTGCAGGTATGCATCCAGTTTGGAT
TCGTGGTCCTGTTTGCCGCCGTTGCCCCATTTGCCGCCATTGGAGCTCTG
CTGAACAACGTCTTTGCGGTGCACATTGATATGTGGAAGCTGTGCAACAT
CTTTAAGCGACCATTTGCAAGGCGCGCCAAGAACATCGGCGCCTGGCAGC
TGGCCTTCGAGCTGCTCTCAGTGATGTCGTTGCTTAGCAACTGCGGTCTG
CTCTTCCTTCAGCCGAATGTCAAGGACTTCTTCTCTCACTGGCTGCCATC
GGTGCCGGATCTTTCGTTCGTAATCTTCGAACACTTGCTGCTGGGCCTGA
AGTTTCTCATCCACAAGGTTATTCACGAAAGGCCGCGCTGGGTGCGCATC
GGACTGCTAAAGGCGGACTTCGAGACCAGCCAGGCTCTCAAGCAACTCAA
AAAATTCAAGGCGGAGGCCAACAAGATGGCCTGATGGGCCACAAGATCGC
CGGATCTCCCACTCCACTCCTTTTGGTGCTAATGAAACCAGTCCATTTTA
AATGTTATTATTTATAAACATACGACTAATCGCGTTTACCGCGAATGTTC
GAGACCAACGGAAGTAAGGTGCCTTAAACCTAAAACTCATATAAATATGT
CCACAGAGTACTTAAAAAAAAAAAAAAAAAA

LP10412.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:56:37
Subject Length Description Subject Range Query Range Score Percent Strand
Axs-RB 2939 Axs-RB 1..2915 1..2915 14575 100 Plus
Axs-RA 2644 Axs-RA 1257..2620 1552..2915 6820 100 Plus
Axs-RA 2644 Axs-RA 44..1257 1..1214 6070 100 Plus
sing-RA 898 sing-RA 800..898 2915..2817 495 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:59:24
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 16570280..16571802 2524..1002 7555 99.7 Minus
chrX 22417052 chrX 16573100..16573575 476..1 2365 99.8 Minus
chrX 22417052 chrX 16571881..16572152 1001..730 1360 100 Minus
chrX 22417052 chrX 16569771..16569981 2913..2701 985 98.6 Minus
chrX 22417052 chrX 16570044..16570224 2700..2520 860 98.3 Minus
chrX 22417052 chrX 16572889..16573037 623..475 745 100 Minus
chrX 22417052 chrX 16572706..16572815 731..622 535 99.1 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:59:19
Subject Length Description Subject Range Query Range Score Percent Strand
Axs-RA 1941 CG9703-PA 759..1941 1552..2734 5915 100 Plus
Axs-RA 1941 CG9703-PA 1..759 456..1214 3795 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:54:27 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:59:18
Subject Length Description Subject Range Query Range Score Percent Strand
Axs-RA 2575 CG9703-RA 1214..2575 1552..2913 6810 100 Plus
Axs-RA 2575 CG9703-RA 1..1214 1..1214 6070 100 Plus
sing-RA 2271 CG13011-RA 1087..2271 2524..1340 5925 100 Minus
sing-RA 2271 CG13011-RA 576..788 2913..2701 1065 100 Minus
sing-RA 2271 CG13011-RA 851..1031 2700..2520 890 99.4 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:59:22
Subject Length Description Subject Range Query Range Score Percent Strand
Axs-PA 646 CG9703-PA 257..646 1562..2731 1880 100 Plus
Axs-PA 646 CG9703-PA 1..254 456..1217 1315 99.6 Plus
CG15270-PB 1259 CG15270-PB 353..758 1562..2668 382 30.5 Plus
CG15270-PE 1292 CG15270-PE 353..758 1562..2668 382 30.5 Plus
CG15270-PF 1305 CG15270-PF 353..758 1562..2668 382 30.5 Plus
CG15270-PA 1338 CG15270-PA 353..758 1562..2668 382 30.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:59:14
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16680600..16682122 2524..1002 7615 100 Minus
X 23542271 X 16683420..16683895 476..1 2380 100 Minus
X 23542271 X 16682201..16682472 1001..730 1360 100 Minus
X 23542271 X 16680087..16680301 2915..2701 1075 100 Minus
X 23542271 X 16680364..16680544 2700..2520 890 99.4 Minus
X 23542271 X 16683209..16683357 623..475 745 100 Minus
X 23542271 X 16683026..16683135 731..622 550 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:28:56
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 16688698..16690220 2524..1002 7615 100 Minus
X 23527363 X 16691518..16691993 476..1 2380 100 Minus
X 23527363 X 16690299..16690570 1001..730 1360 100 Minus
X 23527363 X 16688185..16688399 2915..2701 1075 100 Minus
X 23527363 X 16688462..16688642 2700..2520 890 99.4 Minus
X 23527363 X 16691307..16691455 623..475 745 100 Minus
X 23527363 X 16691124..16691233 731..622 550 100 Minus
Blast to na_te.dros performed 2014-11-26 19:59:16
Subject Length Description Subject Range Query Range Score Percent Strand
S2 1735 S2 S2 1735bp 10..62 1248..1300 139 73.6 Plus
S2 1735 S2 S2 1735bp 1670..1726 1305..1248 125 70.7 Minus

LP10412.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:31:14 Download gff for LP10412.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 16573102..16573575 1..474 99   Minus
chrX 16572889..16573037 475..623 100 <- Minus
chrX 16572707..16572813 624..730 99 <- Minus
chrX 16571881..16572151 731..1001 100 <- Minus
chrX 16570281..16571802 1002..2523 99 <- Minus
chrX 16570044..16570220 2524..2700 98 <- Minus
chrX 16569771..16569981 2701..2913 98 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:40:34 Download gff for LP10412.complete
Subject Subject Range Query Range Percent Splice Strand
Axs-RA 1..758 456..1213 100 == Plus
Axs-RA 759..1941 1552..2734 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:35:17 Download gff for LP10412.complete
Subject Subject Range Query Range Percent Splice Strand
Axs-RA 759..1941 1552..2734 100   Plus
Axs-RA 1..758 456..1213 100 == Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:57:40 Download gff for LP10412.complete
Subject Subject Range Query Range Percent Splice Strand
Axs-RA 759..1941 1552..2734 100   Plus
Axs-RA 1..758 456..1213 100 == Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:26:53 Download gff for LP10412.complete
Subject Subject Range Query Range Percent Splice Strand
Axs-RA 1..758 456..1213 100 == Plus
Axs-RA 759..1941 1552..2734 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:31:14 Download gff for LP10412.complete
Subject Subject Range Query Range Percent Splice Strand
Axs-RA 759..1941 1552..2734 100   Plus
Axs-RA 1..758 456..1213 100 == Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:06:48 Download gff for LP10412.complete
Subject Subject Range Query Range Percent Splice Strand
Axs-RB 1..2911 1..2911 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:35:16 Download gff for LP10412.complete
Subject Subject Range Query Range Percent Splice Strand
Axs-RB 1..2911 1..2911 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:57:40 Download gff for LP10412.complete
Subject Subject Range Query Range Percent Splice Strand
Axs-RA 1214..2575 1552..2913 100   Plus
Axs-RA 1..1213 1..1213 100 == Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:26:53 Download gff for LP10412.complete
Subject Subject Range Query Range Percent Splice Strand
Axs-RB 1..2911 1..2911 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:31:14 Download gff for LP10412.complete
Subject Subject Range Query Range Percent Splice Strand
Axs-RA 1214..2575 1552..2913 100   Plus
Axs-RA 1..1213 1..1213 100 == Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:31:14 Download gff for LP10412.complete
Subject Subject Range Query Range Percent Splice Strand
X 16683422..16683895 1..474 100   Minus
X 16683209..16683357 475..623 100 <- Minus
X 16683027..16683133 624..730 100 <- Minus
X 16682201..16682471 731..1001 100 <- Minus
X 16680601..16682122 1002..2523 100 <- Minus
X 16680364..16680540 2524..2700 100 <- Minus
X 16680089..16680301 2701..2913 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:57:40 Download gff for LP10412.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16577455..16577928 1..474 100   Minus
arm_X 16577242..16577390 475..623 100 <- Minus
arm_X 16577060..16577166 624..730 100 <- Minus
arm_X 16576234..16576504 731..1001 100 <- Minus
arm_X 16574634..16576155 1002..2523 100 <- Minus
arm_X 16574397..16574573 2524..2700 100 <- Minus
arm_X 16574122..16574334 2701..2913 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:59:20 Download gff for LP10412.complete
Subject Subject Range Query Range Percent Splice Strand
X 16691520..16691993 1..474 100   Minus
X 16691307..16691455 475..623 100 <- Minus
X 16691125..16691231 624..730 100 <- Minus
X 16690299..16690569 731..1001 100 <- Minus
X 16688699..16690220 1002..2523 100 <- Minus
X 16688462..16688638 2524..2700 100 <- Minus
X 16688187..16688399 2701..2913 100 <- Minus

LP10412.pep Sequence

Translation from 455 to 1222

> LP10412.pep
MSEDAKSPGPRTRNIIENQLFRRQRSLKLEALQRQRTLDSNDGVEGLGAD
TEPFDKTHIVIIFTEKAKLRHCQDVEKIIQEFGIQTTLEIVGKTEKYLYL
SASVDTLLRLADAAELEKMTTTHSMQKFNHGCISDFLLPGMGKEQILRYC
EIPVLIKDVIQDGIKSYVQKGYIEDMFPLHDILYLERFNWNLKRTKLPIE
DIRNYFGSSIGLYFGFIEFYTKALIFPSLFGILQYVFDLNISLVCSFYVV
WTTVS*

LP10412.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 18:40:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21728-PA 646 GF21728-PA 1..254 1..254 1221 89 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 18:40:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18235-PA 646 GG18235-PA 1..254 1..254 1334 98 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 18:40:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11928-PA 630 GH11928-PA 1..251 1..254 1058 79.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:40:29
Subject Length Description Subject Range Query Range Score Percent Strand
Axs-PA 646 CG9703-PA 1..254 1..254 1315 99.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 18:40:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15349-PA 643 GI15349-PA 1..252 1..254 1074 81.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 18:40:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12944-PA 644 GL12944-PA 1..250 1..254 1176 86.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 18:40:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21976-PA 644 GA21976-PA 1..250 1..254 1168 86.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 18:40:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13377-PA 646 GM13377-PA 1..254 1..254 1356 99.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 18:40:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15734-PA 646 GD15734-PA 1..254 1..254 1356 99.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 18:40:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19453-PA 642 GJ19453-PA 1..251 1..254 1083 81.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 18:40:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19948-PA 651 GK19948-PA 1..259 1..254 1109 79.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 18:40:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15653-PA 646 GE15653-PA 1..254 1..254 1328 97.6 Plus

LP10412.hyp Sequence

Translation from 1615 to 2733

> LP10412.hyp
MSSLDKPRSAYTGQLKPDPITGKMTLHYPMRYTYLQMYCISYPVVLGCVV
AAGWFALYQFQIEAEVLADFGPDSWLLYVPVIVQSVLIAIFSWAYEKLAT
FLTNLENHRTRSQYDRHRVNKLMLFEIVNNFFSQFYIAFVLHDLRQLKYQ
LMMQLLVFQLLCIAQEIGIPLLAVLRQKYAEFRHREVAEEKLRSISDLPR
YEQSFYESGLDEYHSTYEDYLQVCIQFGFVVLFAAVAPFAAIGALLNNVF
AVHIDMWKLCNIFKRPFARRAKNIGAWQLAFELLSVMSLLSNCGLLFLQP
NVKDFFSHWLPSVPDLSFVIFEHLLLGLKFLIHKVIHERPRWVRIGLLKA
DFETSQALKQLKKFKAEANKMA*

LP10412.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:48:39
Subject Length Description Subject Range Query Range Score Percent Strand
Axs-PA 646 CG9703-PA 275..646 1..372 1940 100 Plus
CG15270-PB 1259 CG15270-PB 376..758 4..351 434 30.2 Plus
CG15270-PE 1292 CG15270-PE 376..758 4..351 434 30.2 Plus
CG15270-PF 1305 CG15270-PF 376..758 4..351 434 30.2 Plus
CG15270-PA 1338 CG15270-PA 376..758 4..351 434 30.2 Plus