Clone LP10562 Report

Search the DGRC for LP10562

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:105
Well:62
Vector:pOT2
Associated Gene/TranscriptCG3566-RB
Protein status:LP10562.pep: gold
Sequenced Size:498

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Lost to the ancients 2010-01-14 I'm sure there was a reason

Clone Sequence Records

LP10562.complete Sequence

498 bp assembled on 2010-01-18

GenBank Submission: BT120140.1

> LP10562.complete
GCGCAGTCAGGCAAGATGAGCAAGGAAATCCGTTTGGCCACCGTCAACGA
ACACAACAAAGCCACGGATCTGTGGGTGGTCATCGACAACAAGGTCTACG
ATGTGACCAAGTTCCGTCTCGAGCATCCCGGTGGCGAGGAATCCCTGGTG
GATGAGGCCGGTCGCGATGCCACCAAGGCCTTCAATGACGTGGGTCACAG
CTCGGAGGCGAGAGAGATGTTGAAGAAATACTACATTGGTGACCTGGCTG
CTGCGGACATCAAGAAGAAAAGCCCAATTAGCTGCCGTCATGTGGCACTG
GCCCTGGGCGCCGCCTTCATCGGCATCTCGCTGGTCTATGTGATCCGACG
CGGTGTGGCCAGAAACTAGTCTGCGGCCGGACTGCATTACGAGATTCCAG
ATATATTCCCCCAATTTGGGAACATCAATTTCCTCACACATTTGACACGA
AATAAATTGTACAAATTGCTTAAATTACACAAAAAAAAAAAAAAAAAA

LP10562.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:34:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG3566-RB 645 CG3566-RB 164..645 1..482 2410 100 Plus
CG3566-RC 1631 CG3566-RC 93..373 1..281 1405 100 Plus
CG3566.a 748 CG3566.a 93..373 1..281 1405 100 Plus
CG3566-RC 1631 CG3566-RC 1429..1631 280..482 1015 100 Plus
CG3566.a 748 CG3566.a 548..748 282..482 1005 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 10:31:04
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 6167158..6167358 480..280 975 99 Minus
chrX 22417052 chrX 6168711..6168833 123..1 600 99.2 Minus
chrX 22417052 chrX 6168550..6168645 212..117 465 99 Minus
chrX 22417052 chrX 6168408..6168478 281..211 340 98.6 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:31:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG3566-RB 354 CG3566-PB 1..354 16..369 1770 100 Plus
CG3566-RD 321 CG3566-PD 1..266 16..281 1330 100 Plus
CG3566-RC 270 CG3566-PC 1..266 16..281 1330 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:54:37 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:31:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG3566-RB 550 CG3566-RB 71..550 1..480 2400 100 Plus
CG3566-RD 770 CG3566-RD 71..351 1..281 1405 100 Plus
CG3566-RC 1607 CG3566-RC 71..351 1..281 1405 100 Plus
CG3566-RD 770 CG3566-RD 570..770 280..480 1005 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 10:31:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG3566-PB 117 CG3566-PB 1..117 16..366 594 100 Plus
CG3566-PD 106 CG3566-PD 1..89 16..282 456 100 Plus
CG3566-PC 89 CG3566-PC 1..88 16..279 452 100 Plus
Cyt-b5-PB 134 CG2140-PB 2..85 7..258 238 51.2 Plus
CG6870-PB 137 CG6870-PB 43..116 25..246 205 52.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:30:58
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 6274970..6275172 482..280 1015 100 Minus
X 23542271 X 6276532..6276654 123..1 615 100 Minus
X 23542271 X 6276370..6276465 212..117 465 99 Minus
X 23542271 X 6276228..6276298 281..211 355 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:51:25
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 6283068..6283270 482..280 1015 100 Minus
X 23527363 X 6284630..6284752 123..1 615 100 Minus
X 23527363 X 6284468..6284563 212..117 465 98.9 Minus
X 23527363 X 6284326..6284396 281..211 355 100 Minus
Blast to na_te.dros performed on 2014-11-27 10:30:59 has no hits.

LP10562.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:44:50 Download gff for LP10562.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 6168711..6168833 1..123 99   Minus
chrX 6168550..6168638 124..212 100 <- Minus
chrX 6168408..6168476 213..281 98 <- Minus
chrX 6167158..6167356 282..480 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-18 09:41:19 Download gff for LP10562.complete
Subject Subject Range Query Range Percent Splice Strand
CG3566-RB 1..354 16..369 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:52:53 Download gff for LP10562.complete
Subject Subject Range Query Range Percent Splice Strand
CG3566-RB 1..354 16..369 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:43:33 Download gff for LP10562.complete
Subject Subject Range Query Range Percent Splice Strand
CG3566-RB 1..354 16..369 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:44:50 Download gff for LP10562.complete
Subject Subject Range Query Range Percent Splice Strand
CG3566-RB 1..354 16..369 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-18 09:41:18 Download gff for LP10562.complete
Subject Subject Range Query Range Percent Splice Strand
CG3566-RB 25..504 1..480 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:52:53 Download gff for LP10562.complete
Subject Subject Range Query Range Percent Splice Strand
CG3566-RB 25..504 1..480 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:43:33 Download gff for LP10562.complete
Subject Subject Range Query Range Percent Splice Strand
CG3566-RB 71..550 1..480 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:44:50 Download gff for LP10562.complete
Subject Subject Range Query Range Percent Splice Strand
CG3566-RB 71..550 1..480 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:44:50 Download gff for LP10562.complete
Subject Subject Range Query Range Percent Splice Strand
X 6276532..6276654 1..123 100   Minus
X 6276370..6276458 124..212 100 <- Minus
X 6276228..6276296 213..281 100 <- Minus
X 6274972..6275170 282..480 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:43:33 Download gff for LP10562.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 6170565..6170687 1..123 100   Minus
arm_X 6170403..6170491 124..212 100 <- Minus
arm_X 6170261..6170329 213..281 100 <- Minus
arm_X 6169005..6169203 282..480 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:29:08 Download gff for LP10562.complete
Subject Subject Range Query Range Percent Splice Strand
X 6284630..6284752 1..123 100   Minus
X 6284468..6284556 124..212 100 <- Minus
X 6284326..6284394 213..281 100 <- Minus
X 6283070..6283268 282..480 100 <- Minus

LP10562.pep Sequence

Translation from 0 to 368

> LP10562.pep
AQSGKMSKEIRLATVNEHNKATDLWVVIDNKVYDVTKFRLEHPGGEESLV
DEAGRDATKAFNDVGHSSEAREMLKKYYIGDLAAADIKKKSPISCRHVAL
ALGAAFIGISLVYVIRRGVARN*

LP10562.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 12:50:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20301-PA 117 GF20301-PA 1..117 6..122 504 77.8 Plus
Dana\GF13182-PA 134 GF13182-PA 2..85 3..86 239 52.4 Plus
Dana\GF15091-PA 138 GF15091-PA 37..118 2..83 208 47.6 Plus
Dana\GF10319-PA 119 GF10319-PA 1..79 6..82 182 45.6 Plus
Dana\GF12339-PA 534 GF12339-PA 98..168 18..88 148 42.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 12:50:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17685-PA 117 GG17685-PA 1..117 6..122 566 92.3 Plus
Dere\GG23285-PA 134 GG23285-PA 2..85 3..86 239 51.2 Plus
Dere\GG21732-PA 137 GG21732-PA 42..118 8..84 207 49.4 Plus
Dere\GG13493-PA 119 GG13493-PA 1..91 6..94 196 44 Plus
Dere\GG21968-PA 535 GG21968-PA 98..168 18..88 142 39.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 12:50:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24801-PA 118 GH24801-PA 1..115 6..120 422 64.3 Plus
Dgri\GH20101-PA 134 GH20101-PA 2..88 3..89 243 51.7 Plus
Dgri\GH10148-PA 140 GH10148-PA 42..122 5..85 217 49.4 Plus
Dgri\GH22815-PA 547 GH22815-PA 99..172 18..91 145 39.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:50:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG3566-PB 117 CG3566-PB 1..117 6..122 594 100 Plus
CG3566-PD 106 CG3566-PD 1..89 6..94 456 100 Plus
CG3566-PC 89 CG3566-PC 1..88 6..93 452 100 Plus
Cyt-b5-PB 134 CG2140-PB 2..85 3..86 238 51.2 Plus
CG6870-PB 137 CG6870-PB 43..116 9..82 205 52.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 12:50:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21528-PA 117 GI21528-PA 1..117 6..122 417 63.2 Plus
Dmoj\GI18997-PA 135 GI18997-PA 2..88 3..89 241 54 Plus
Dmoj\GI22344-PA 139 GI22344-PA 44..118 8..82 203 49.3 Plus
Dmoj\GI12677-PA 121 GI12677-PA 1..80 6..83 180 43.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 12:50:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21352-PA 118 GL21352-PA 1..113 6..118 469 76.1 Plus
Dper\GL20014-PA 135 GL20014-PA 2..85 3..86 240 53.6 Plus
Dper\GL18032-PA 132 GL18032-PA 1..79 6..82 196 49.4 Plus
Dper\GL15857-PA 138 GL15857-PA 38..117 4..83 196 46.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 12:50:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17524-PA 118 GA17524-PA 1..113 6..118 471 77 Plus
Dpse\GA15264-PA 135 GA15264-PA 2..85 3..86 240 53.6 Plus
Dpse\GA18697-PA 132 GA18697-PA 1..79 6..82 196 49.4 Plus
Dpse\GA19919-PA 138 GA19919-PA 38..117 4..83 194 46.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 12:50:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12584-PA 76 GM12584-PA 1..76 6..122 302 57.3 Plus
Dsec\GM20961-PA 134 GM20961-PA 2..85 3..86 238 51.2 Plus
Dsec\GM17113-PA 137 GM17113-PA 43..118 9..84 209 51.3 Plus
Dsec\GM24442-PA 119 GM24442-PA 1..91 6..94 195 44 Plus
Dsec\GM21957-PA 535 GM21957-PA 98..174 18..92 148 40.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 12:50:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10488-PA 134 GD10488-PA 2..85 3..86 238 51.2 Plus
Dsim\GD12511-PA 119 GD12511-PA 1..91 6..94 197 45.1 Plus
Dsim\GD21856-PA 136 GD21856-PA 43..117 9..84 192 51.3 Plus
Dsim\GD11452-PA 535 GD11452-PA 98..174 18..92 148 40.3 Plus
Dsim\GD16200-PA 105 GD16200-PA 78..105 95..122 146 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 12:50:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16001-PA 117 GJ16001-PA 1..116 6..121 386 58.6 Plus
Dvir\GJ19962-PA 135 GJ19962-PA 2..85 3..86 246 54.8 Plus
Dvir\GJ20242-PA 104 GJ20242-PA 9..86 8..85 189 42.3 Plus
Dvir\GJ12661-PA 120 GJ12661-PA 1..80 6..83 186 45 Plus
Dvir\GJ20792-PA 539 GJ20792-PA 94..177 13..96 145 35.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 12:50:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19965-PA 118 GK19965-PA 4..118 8..122 412 63.5 Plus
Dwil\GK10686-PA 133 GK10686-PA 12..85 13..86 238 55.4 Plus
Dwil\GK18221-PA 140 GK18221-PA 37..119 1..83 215 47 Plus
Dwil\GK11351-PA 124 GK11351-PA 1..92 6..90 192 44.6 Plus
Dwil\GK22167-PA 528 GK22167-PA 91..155 18..82 144 43.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 12:50:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16473-PA 117 GE16473-PA 1..117 6..122 574 92.3 Plus
Dyak\GE19131-PA 134 GE19131-PA 2..85 3..86 238 51.2 Plus
Dyak\GE13120-PA 137 GE13120-PA 43..118 9..84 207 50 Plus
Dyak\GE22584-PA 119 GE22584-PA 1..91 6..94 199 45.1 Plus
Dyak\GE12047-PA 537 GE12047-PA 98..174 18..92 143 39 Plus

LP10562.hyp Sequence

Translation from 0 to 368

> LP10562.hyp
AQSGKMSKEIRLATVNEHNKATDLWVVIDNKVYDVTKFRLEHPGGEESLV
DEAGRDATKAFNDVGHSSEAREMLKKYYIGDLAAADIKKKSPISCRHVAL
ALGAAFIGISLVYVIRRGVARN*

LP10562.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:19:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG3566-PB 117 CG3566-PB 1..117 6..122 594 100 Plus
CG3566-PD 106 CG3566-PD 1..89 6..94 456 100 Plus
CG3566-PC 89 CG3566-PC 1..88 6..93 452 100 Plus
Cyt-b5-PB 134 CG2140-PB 2..85 3..86 238 51.2 Plus
CG6870-PB 137 CG6870-PB 43..116 9..82 205 52.7 Plus